| PDBID: | 7hty | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z666290862 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htc | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z404993336 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htu | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z56978034 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htv | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z57122377 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htz | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z69092635 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9huc | | Status: | HPUB -- hold until publication | | Title: | The glucuronyl esterase OtCE15A from Opitutus terrae in complex with a heptasaccharide | | Authors: | Oestberg, E.B., Lo Leggio, L., Zaghini, A., Mazurkewich, S., Larsbrink, J. | | Deposition date: | 2024-12-21 | | Sequence: | >Entity 1
GHSAYTLPDPLVGADGTRVHDRATWQHRRRPELLQLFAREVYGRTPLGRPEGMVFKVTTMEHAALGGAATRKEVTVRFGRDPNAPSMQLLLYVPNAVIARAERAPVFLGLNFYGNHTVHTDPAIALSARWIPAEAPNGANHRATEAARGSDAQKWPVEQILARGYAVATVYCGDLCPDRPDGLNASVASWLDAAAGDQRAPDAWGAIGVWAWGLSRALDYLETDPLVDASRVAVHGHSRLGKAALWAGAQDDRFALVISNESGCGGAALSKRIHGETVARINTVFPHWFARNFRRYDDHEEALPVDQHELLALVAPRPLYVASAEDDDWADPRGEFLAVKAAEPVFRLFGQTGPSGEDVPRVNEPSGGALRYHIRPGPHGMTAQDWAFYLAFADEWLKSALPA
|
|
| PDBID: | 9hu5 | | Status: | HPUB -- hold until publication | | Title: | Asymmetric unit from transcribing single-layered particle of bacteriophage phi6 | | Authors: | Ilca, S.L., Kumpula, E.-P., Huiskonen, J.T. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9htw | | Status: | HPUB -- hold until publication | | Title: | Minor protein P7 dimer from transcribing particles of bacteriophage phi6 | | Authors: | Kumpula, E.-P., Huiskonen, J.T. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9hu6 | | Status: | HPUB -- hold until publication | | Title: | Asymmetric unit from transcribing single-layered particle of bacteriophage phi6 in an over-expanded state | | Authors: | Ilca, S.L., Kumpula, E.-P., Huiskonen, J.T. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9hu8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with MC-278. | | Authors: | Callens, M.C., Thompson, A.P., Gray, J.L., von Delft, F., Brennan, P.E. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mmy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E. coli GroEL bound with ATP and PBZ1587 inhibitor | | Authors: | Johnson, S.M., Chen, Q. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mmz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E. coli SR1 single-ring GroEL oligomer | | Authors: | Johnson, S.M., Chen, Q. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mn0 | | Status: | HPUB -- hold until publication | | Title: | E. coli SR1 single-ring GroEL templated into pseudo-double-ring complex with PBZ1587 inhibitor | | Authors: | Johnson, S.M., Chen, Q. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mn1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E. coli SR1 single-ring GroEL oligomer | | Authors: | Johnson, S.M., Chen, Q. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mn3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E. coli GroES-GroEL-GroES football complex | | Authors: | Johnson, S.M., Chen, Q. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mmf | | Status: | HPUB -- hold until publication | | Title: | First structure of Five-tetrad G-Quadruplex | | Authors: | Eyiolowope, J., Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9ht3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PA0884, the SBP component of a Pseudomonas aeruginosa PAO1 Tripartite ATP-independent Periplasmic (TRAP) transporter, complexed with itaconate | | Authors: | Herman, R., Mehboob, J., Elston, R., Afolabi, H., Kinniment-Williams, B.E., Wilkinson, A.J., Thomas, G.H. | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
AQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9ht5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of YIUA from Yersinia ruckeri with Iron and nitrilotriacetic acid | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hs9 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus (unclear crosslink from Lys), damage-free | | Authors: | Pfalzgraf, H.E., Adams, H.R., Sugimoto, H., Tosha, T., Horrell, S., Jaho, S., Beilsten-Edmands, J., Tews, I., Worrall, J.A.R., Owen, R.L., Hough, M.A. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht7 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crosslinked complex of ketosynthase FabB mutant FabBG107M and acyl carrier protein AcpP from E.coli with C12 crosslinker | | Authors: | Jiang, Z., Sankaran, B., Burkart, M.D., Fox, J.M. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mld | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Portal Protein from Finegoldia magna phage Miquella | | Authors: | Harlington, A.H., Fechner, M.R., Hao, N., Shearwin, K.E., Whelan, F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hrs | | Status: | HPUB -- hold until publication | | Title: | ZnT1 CTD regulation | | Authors: | Ben-Yosef, T.E., Zarivach, R., Shahar, A. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrk | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus in the ferrous state (single crosslink from Lys) | | Authors: | Pfalzgraf, H.E., Adams, H.R., Jaho, S., Hough, M.A. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrj | | Status: | HPUB -- hold until publication | | Title: | Structure of YIUA from Yersinia ruckeri | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-18 |
|
