PDBID: | 9qj2 | Status: | HPUB -- hold until publication | Title: | Titin kinase (isoform b) from medaka | Authors: | Dorendorf, T., Mayans, O. | Deposition date: | 2025-03-18 |
|
PDBID: | 9u3h | Status: | HPUB -- hold until publication | Title: | Serine Beta-lactamase OXA-48 in complex with dual MBL/SBL inhibitor FB1-12 | Authors: | Li, G.-B., Liang, G.-Q. | Deposition date: | 2025-03-18 |
|
PDBID: | 9u3g | Status: | AUTH -- processed, waiting for author review and approval | Title: | Serine Beta-lactamase OXA-48 in complex with dual MBL/SBL inhibitor FB1-3 | Authors: | Li, G.-B., Liang, G.-Q. | Deposition date: | 2025-03-18 |
|
PDBID: | 9nsn | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-41059 | Authors: | Mabanglo, M.F., Wilson, B.J., Mamai, A., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2025-03-17 |
|
PDBID: | 9nso | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-41060 | Authors: | Mabanglo, M.F., Wilson, B.J., Mamai, A., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2025-03-17 |
|
PDBID: | 9mb4 | Status: | HPUB -- hold until publication | Title: | Metal Beta Lactamase NDM-1 in Complex with Dual MBL/SBL Inhibitor 14 | Authors: | Li, G.-B., Yang, Z.-B., Wei, S.-Q. | Deposition date: | 2025-03-15 |
|
PDBID: | 9qh2 | Status: | HPUB -- hold until publication | Title: | wild-type APO Purine Nucleoside Phosphorylase from Parageobacillus thermoglucosidasius | Authors: | Westarp, S., Williams, E.P., Koekemoer, L., Bradshaw, W., Marx, M., Elkins, J., MacLean, B., Wright, N. | Deposition date: | 2025-03-14 |
|
PDBID: | 9qgy | Status: | HPUB -- hold until publication | Title: | Structure of the YbjP lipoprotein bound to the MacAB-TolC tripartite efflux pump | Authors: | Kaplan, E., Horne, J., Luisi, B.F. | Deposition date: | 2025-03-14 | Sequence: | >Entity 1 ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGADYTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGNYYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLAREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPVSTNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN
>Entity 2 CTTVTPAYKDNGTRSGPCVEGGPDNVAQQFYDYRILHRSNDITALRPYLSDKLATLLSDASRDNNHRELLTNDPFSSRTTLPDSAHVASASTIPNRDARNIPLRVDLKQGDQGWQDEVLMIQEGQCWVIDDVRYLGGSVHATAGTLRQSIENR
>Entity 3 MKKRKTVKKRYVIALVIVIAGLITLWRILNAPVPTYQTLIVRPGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTKAVSQQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLTIPLSALGDPVGDNRYKVKLLRNGETREREVTIGARNDTDVEIVKGLEAGDEVVIGEAKPGAAQ
>Entity 4 MVLADIRSIGTNTIDVYPGKDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRYNNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVVGEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGFDSAEAEQQLTRLLSLRHGKKDFFTWNM
|
|
PDBID: | 9map | Status: | HPUB -- hold until publication | Title: | Crystal structure of GAGWLP and PD-L1 | Authors: | Yang, P., Chen, M.R., Xiao, Y.B. | Deposition date: | 2025-03-14 |
|
PDBID: | 9mas | Status: | HPUB -- hold until publication | Title: | Metal Beta Lactamase VIM-2 in Complex with Dual MBL/SBL Inhibitor 3 | Authors: | Li, G.-B., Yang, Z.-B., Wei, S.-Q. | Deposition date: | 2025-03-14 |
|
PDBID: | 9mar | Status: | HPUB -- hold until publication | Title: | Serine Beta Lactamase OXA-48 in Complex with Dual MBL/SBL Inhibitor 19 | Authors: | Li, G.-B., Yang, Z.-B., Wei, S.-Q. | Deposition date: | 2025-03-14 |
|
PDBID: | 9nrq | Status: | HOLD -- hold until a certain date | Title: | GloR with glyoxal modification | Authors: | Cuthbert, B.J., de Miranda, R., Martinez, J., Goulding, C.W. | Deposition date: | 2025-03-14 | Release date: | 2026-03-14 |
|
PDBID: | 9qgk | Status: | HOLD -- hold until a certain date | Title: | F-actin decorated by ITPKA | Authors: | Yuan, B., Paraschiakos, T., Windhorst, S., Marlovits, T.C. | Deposition date: | 2025-03-13 | Release date: | 2026-03-13 |
|
PDBID: | 7i8s | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0024999-003 (A71EV2A-x1775) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-13 |
|
PDBID: | 7i8t | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030340-001 (A71EV2A-x2290) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-13 |
|
PDBID: | 7i8u | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0019110-002 (A71EV2A-x2454) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-13 |
|
PDBID: | 7i8v | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030531-001 (A71EV2A-x2629) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-13 |
|
PDBID: | 7i8w | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018935-002 (A71EV2A-x3066) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-13 |
|
PDBID: | 9nqh | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of A. thaliana FUT4 | Authors: | Mallinson, S.J.B. | Deposition date: | 2025-03-12 | Release date: | 2025-05-07 |
|
PDBID: | 9nqg | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of poplar mannan-O-acetyltransferase 1 | Authors: | Mallinson, S.J.B., Lunin, V.V. | Deposition date: | 2025-03-12 | Release date: | 2025-05-07 |
|
PDBID: | 9nqf | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of poplar mannan-O-acetyltransferase 1 | Authors: | Mallinson, S.J.B. | Deposition date: | 2025-03-12 | Release date: | 2025-05-07 |
|
PDBID: | 9qf9 | Status: | HPUB -- hold until publication | Title: | Structure of the GH13 domain of Ruminococcus bromii Amy16 | Authors: | Wimmer, B.H., Medalia, O. | Deposition date: | 2025-03-11 |
|
PDBID: | 9qf3 | Status: | HPUB -- hold until publication | Title: | Structure of the GH13 domain of Ruminococcus bromii Amy4 | Authors: | Wimmer, B.H., Medalia, O. | Deposition date: | 2025-03-11 |
|
PDBID: | 9qf8 | Status: | HPUB -- hold until publication | Title: | Structure of the GH13 and MucBP domains of Ruminococcus bromii Amy10 | Authors: | Wimmer, B.H., Medalia, O. | Deposition date: | 2025-03-11 |
|
PDBID: | 9qfa | Status: | HPUB -- hold until publication | Title: | Structure of the GH13 and MucBP domains of Ruminococcus bromii Amy12 | Authors: | Wimmer, B.H., Medalia, O. | Deposition date: | 2025-03-11 |
|