Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9qj2
Status:HPUB -- hold until publication
Title:Titin kinase (isoform b) from medaka
Authors:Dorendorf, T., Mayans, O.
Deposition date:2025-03-18
PDBID:9u3h
Status:HPUB -- hold until publication
Title:Serine Beta-lactamase OXA-48 in complex with dual MBL/SBL inhibitor FB1-12
Authors:Li, G.-B., Liang, G.-Q.
Deposition date:2025-03-18
PDBID:9u3g
Status:AUTH -- processed, waiting for author review and approval
Title:Serine Beta-lactamase OXA-48 in complex with dual MBL/SBL inhibitor FB1-3
Authors:Li, G.-B., Liang, G.-Q.
Deposition date:2025-03-18
PDBID:9nsn
Status:HPUB -- hold until publication
Title:Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-41059
Authors:Mabanglo, M.F., Wilson, B.J., Mamai, A., Hoffer, L., Al-awar, R., Vedadi, M.
Deposition date:2025-03-17
PDBID:9nso
Status:HPUB -- hold until publication
Title:Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-41060
Authors:Mabanglo, M.F., Wilson, B.J., Mamai, A., Hoffer, L., Al-awar, R., Vedadi, M.
Deposition date:2025-03-17
PDBID:9mb4
Status:HPUB -- hold until publication
Title:Metal Beta Lactamase NDM-1 in Complex with Dual MBL/SBL Inhibitor 14
Authors:Li, G.-B., Yang, Z.-B., Wei, S.-Q.
Deposition date:2025-03-15
PDBID:9qh2
Status:HPUB -- hold until publication
Title:wild-type APO Purine Nucleoside Phosphorylase from Parageobacillus thermoglucosidasius
Authors:Westarp, S., Williams, E.P., Koekemoer, L., Bradshaw, W., Marx, M., Elkins, J., MacLean, B., Wright, N.
Deposition date:2025-03-14
PDBID:9qgy
Status:HPUB -- hold until publication
Title:Structure of the YbjP lipoprotein bound to the MacAB-TolC tripartite efflux pump
Authors:Kaplan, E., Horne, J., Luisi, B.F.
Deposition date:2025-03-14
Sequence:

>Entity 1


ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGADYTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGNYYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLAREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPVSTNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN

>Entity 2


CTTVTPAYKDNGTRSGPCVEGGPDNVAQQFYDYRILHRSNDITALRPYLSDKLATLLSDASRDNNHRELLTNDPFSSRTTLPDSAHVASASTIPNRDARNIPLRVDLKQGDQGWQDEVLMIQEGQCWVIDDVRYLGGSVHATAGTLRQSIENR

>Entity 3


MKKRKTVKKRYVIALVIVIAGLITLWRILNAPVPTYQTLIVRPGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTKAVSQQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLTIPLSALGDPVGDNRYKVKLLRNGETREREVTIGARNDTDVEIVKGLEAGDEVVIGEAKPGAAQ

>Entity 4


MVLADIRSIGTNTIDVYPGKDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRYNNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVVGEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGFDSAEAEQQLTRLLSLRHGKKDFFTWNM
PDBID:9map
Status:HPUB -- hold until publication
Title:Crystal structure of GAGWLP and PD-L1
Authors:Yang, P., Chen, M.R., Xiao, Y.B.
Deposition date:2025-03-14
PDBID:9mas
Status:HPUB -- hold until publication
Title:Metal Beta Lactamase VIM-2 in Complex with Dual MBL/SBL Inhibitor 3
Authors:Li, G.-B., Yang, Z.-B., Wei, S.-Q.
Deposition date:2025-03-14
PDBID:9mar
Status:HPUB -- hold until publication
Title:Serine Beta Lactamase OXA-48 in Complex with Dual MBL/SBL Inhibitor 19
Authors:Li, G.-B., Yang, Z.-B., Wei, S.-Q.
Deposition date:2025-03-14
PDBID:9nrq
Status:HOLD -- hold until a certain date
Title:GloR with glyoxal modification
Authors:Cuthbert, B.J., de Miranda, R., Martinez, J., Goulding, C.W.
Deposition date:2025-03-14
Release date:2026-03-14
PDBID:9qgk
Status:HOLD -- hold until a certain date
Title:F-actin decorated by ITPKA
Authors:Yuan, B., Paraschiakos, T., Windhorst, S., Marlovits, T.C.
Deposition date:2025-03-13
Release date:2026-03-13
PDBID:7i8s
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0024999-003 (A71EV2A-x1775)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:7i8t
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030340-001 (A71EV2A-x2290)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:7i8u
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0019110-002 (A71EV2A-x2454)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:7i8v
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030531-001 (A71EV2A-x2629)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:7i8w
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018935-002 (A71EV2A-x3066)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:9nqh
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of A. thaliana FUT4
Authors:Mallinson, S.J.B.
Deposition date:2025-03-12
Release date:2025-05-07
PDBID:9nqg
Status:HOLD -- hold until a certain date
Title:Crystal structure of poplar mannan-O-acetyltransferase 1
Authors:Mallinson, S.J.B., Lunin, V.V.
Deposition date:2025-03-12
Release date:2025-05-07
PDBID:9nqf
Status:HOLD -- hold until a certain date
Title:Crystal structure of poplar mannan-O-acetyltransferase 1
Authors:Mallinson, S.J.B.
Deposition date:2025-03-12
Release date:2025-05-07
PDBID:9qf9
Status:HPUB -- hold until publication
Title:Structure of the GH13 domain of Ruminococcus bromii Amy16
Authors:Wimmer, B.H., Medalia, O.
Deposition date:2025-03-11
PDBID:9qf3
Status:HPUB -- hold until publication
Title:Structure of the GH13 domain of Ruminococcus bromii Amy4
Authors:Wimmer, B.H., Medalia, O.
Deposition date:2025-03-11
PDBID:9qf8
Status:HPUB -- hold until publication
Title:Structure of the GH13 and MucBP domains of Ruminococcus bromii Amy10
Authors:Wimmer, B.H., Medalia, O.
Deposition date:2025-03-11
PDBID:9qfa
Status:HPUB -- hold until publication
Title:Structure of the GH13 and MucBP domains of Ruminococcus bromii Amy12
Authors:Wimmer, B.H., Medalia, O.
Deposition date:2025-03-11

243083

数据于2025-10-15公开中

PDB statisticsPDBj update infoContact PDBjnumon