| PDBID: | 9pxr | | Status: | HPUB -- hold until publication | | Title: | Human malic enzyme 1 complex with inhibitor NPD-389 at 2.3 Angstrom. | | Authors: | Krinkel, B.A., Yosaatmadja, Y., Squire, C.J., Loomes, K.M. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ili | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with POB0029 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7il2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z53834613 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9w7d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | cryo-EM structure of PSII PsbA3-S264V in complex with DCMU from Thermosynechococcus vestitus BP-1 | | Authors: | Fan, S.B., Jiang, H.W., Kato, K., Tsai, P.-C., Jia, A.Q., Nakajima, Y., Sugiura, M., Shen, J.R. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9w7u | | Status: | HPUB -- hold until publication | | Title: | SuperFi Cas9 - 20nt sgRNA - DNA ternary complex Class C | | Authors: | Zheng, R., Ma, L.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9s8j | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant R191Q associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Meyer, S.C., Jose, J., Niefind, K. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s7u | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human glutamate carboxypeptidase II (GCPII) - the E424M inactive mutant, in complex with an inhibitor Ac-gamma-Glu-Dap(thiooxalyl)-OH | | Authors: | Novakova, Z., Schenkmayerova, A., Motlova, L., Barinka, C. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s7r | | Status: | HPUB -- hold until publication | | Title: | Structure of the de novo protein scaffold MID1sc9_4xE | | Authors: | Klassen, R., Heider, A., Kugler, H., Groll, M., Zeymer, C. | | Deposition date: | 2025-08-05 | | Sequence: | >Entity 1
GGMGPLAQQIKNTLTFIGQANAAGRMDEVRTLQENLEPLWEEYFQQTEGSGGSPLAQQIEYGEVLIEQARAAGRMDEVRRLSENTLQLMKEYFQQSD
|
|
| PDBID: | 9pxa | | Status: | HPUB -- hold until publication | | Title: | BG505/CH505wk4 Env chimeric SOSIP in complex with CH103 and RM19R Fabs | | Authors: | Cottrell, C.A., Ozorowski, G., Wu, N.R., Ward, A.B. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9px9 | | Status: | HPUB -- hold until publication | | Title: | ATTR V122I cardiac amyloid fibrils | | Authors: | Schaefer, J.H., Lander, G.C. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9pxe | | Status: | HPUB -- hold until publication | | Title: | JRFL.TD15 membrane Env liposome in complex with CH103.H17L8 Fab | | Authors: | Karlinsey, D.C., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s76 | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant Y50C associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9s77 | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant S51R associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9s7a | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant R80C associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Meyer, S.C., Jose, J., Niefind, K. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9s7h | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant H160R associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9s7i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of protein kinase CK2alpha mutant D175G associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9pvo | | Status: | HPUB -- hold until publication | | Title: | Novel site 1 interaction of the IR/Ins-AC-S2 complex | | Authors: | Vogel, A., Blakely, A., Hill, C.P. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pvn | | Status: | HPUB -- hold until publication | | Title: | Human malic enzyme 3 complex with inhibitor NPD-389 at 1.82 Angstrom. | | Authors: | Krinkel, B.A., Yosaatmadja, Y., Squire, C.J., Loomes, K.M. | | Deposition date: | 2025-08-02 |
|
| PDBID: | 9w5s | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the LdcEt3 (P233C/L628C mutant)-PLP-thiaLys at pH 8.0, 0.3% Na[BF4] | | Authors: | Huang, Y., Xing, Q., Huang, C.H., Lin, K.F., Chen, C.Y., Zhang, S. | | Deposition date: | 2025-08-02 |
|
| PDBID: | 9s6g | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant R47Q associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Buchwald, L., Niefind, K. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9s6l | | Status: | HPUB -- hold until publication | | Title: | Structure of C. tepidum Rel in an open state in complex with APCPP and GDP | | Authors: | Garcia-Pino, A. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9s6k | | Status: | HPUB -- hold until publication | | Title: | Structure of C. tepidum Rel in an open state in complex with Nb898 | | Authors: | Garcia-Pino, A., Van Nerom, K., Talavera Perez, A. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9pvh | | Status: | HPUB -- hold until publication | | Title: | Human Cullin-4 in complex with CAND2 | | Authors: | Kenny, S., Liu, X., Das, C. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9pva | | Status: | HPUB -- hold until publication | | Title: | 295-330 S320F tau | | Authors: | Jayan, P., Dashnaw, C.M., Joachimiak, L.A. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9pve | | Status: | HPUB -- hold until publication | | Title: | HRAS complex with UM0152533 compound | | Authors: | Jo, C., Lavoie, H., Therrien, M. | | Deposition date: | 2025-08-01 |
|
