Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8px6
Status:HPUB -- hold until publication
Title:Hepatitis B core protein with bound SLLGRM-dimer
Authors:Makbul, C., Khayenko, V., Maric, M.H., Bottcher, B.
Deposition date:2023-07-22
PDBID:8pwc
Status:HPUB -- hold until publication
Title:Crystal structure of MDM2 with BI 907828.
Authors:Bader, G., Wolkerstorfer, B.
Deposition date:2023-07-20
PDBID:8pwk
Status:HPUB -- hold until publication
Title:human HINT1 in complex with compound AT8003
Authors:Zimberger, C., Canard, B., Ferron, F.
Deposition date:2023-07-20
PDBID:8pts
Status:HPUB -- hold until publication
Title:human GUK1 in complex with compound AT8001
Authors:Zimberger, C., Canard, B., Ferron, F.
Deposition date:2023-07-14
Sequence:

>Entity 1


MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
PDBID:8k19
Status:HOLD -- hold until a certain date
Title:Neutralization antibody ZCP3B4 bound with SARS-CoV-2 Omicron BA.5 RBD
Authors:Tang, B., Dang, S.
Deposition date:2023-07-10
Release date:2025-01-22
PDBID:8tac
Status:HPUB -- hold until publication
Title:Designed DNA binding protein
Authors:Doyle, L., Stoddard, B.L., Glasscock, C.J., McHugh, R.P., Pecoraro, R.J.
Deposition date:2023-06-27
PDBID:8pie
Status:HPUB -- hold until publication
Title:Crystal structure of the human nucleoside diphosphate kinase B domain in complex with the product AT-8500 formed by catalysis of compound AT-9010
Authors:Feracci, M., Chazot, A., Ferron, F., Alvarez, K., Canard, B.
Deposition date:2023-06-21
Release date:2024-12-26
PDBID:8jq2
Status:HOLD -- hold until a certain date
Title:Cryo-EM structures of a heme transporter in the heme a biosynthesis pathway of Mycobacteria tuberculosis
Authors:Chen, X.B., Li, J.
Deposition date:2023-06-13
Release date:2024-12-13
PDBID:8jq7
Status:HOLD -- hold until a certain date
Title:Cryo-EM structures of a heme-bound transporter in the heme a biosynthesis pathway of Mycobacteria tuberculosis
Authors:Chen, X.B., Li, J.
Deposition date:2023-06-13
Release date:2024-12-13
PDBID:8jq8
Status:HOLD -- hold until a certain date
Title:Cryo-EM structures of a heme transporter bound to ATP in the heme a biosynthesis pathway of Mycobacteria tuberculosis
Authors:Chen, X.B., Li, J.
Deposition date:2023-06-13
Release date:2024-12-13
PDBID:8sw3
Status:HPUB -- hold until publication
Title:BG505 GT1.1 SOSIP in complex with NHP Fabs 12C11 and RM20A3
Authors:Zhang, S., Torres, J.L., Ozorowski, G., Ward, A.B.
Deposition date:2023-05-17
Release date:2024-11-16
PDBID:8sj6
Status:HPUB -- hold until publication
Title:Ara h 2.01 38B7 8F3
Authors:Spiller, B.W., Shrem, R.A.
Deposition date:2023-04-17
Release date:2024-10-17
PDBID:8sja
Status:HPUB -- hold until publication
Title:Ara H 6 13D9 16A8
Authors:Spiller, B.W., Shrem, R.A.
Deposition date:2023-04-17
Release date:2024-10-17
PDBID:8si1
Status:HPUB -- hold until publication
Title:Ara h 6 16A8 complex
Authors:Spiller, B.W., Shrem, R.A.
Deposition date:2023-04-14
Release date:2024-10-14
PDBID:8scw
Status:HPUB -- hold until publication
Title:Crystal structure of IRAK4-HSA complexed with BMS-986147; 6-{5-CYANO-1H-PYRAZOLO[3,4-B]PYRIDIN-1-YL}-N-[(2R)-2-FLUORROXY-3-METHYLBUTYL]-4-[(PROPAN-2-YL)AMINO]PYRIDINE-3-CARBOXAMIDE
Authors:Muckelbauer, J.K., Ghosh, K.
Deposition date:2023-04-05
Release date:2024-12-31
PDBID:8ipf
Status:HOLD -- hold until a certain date
Title:Crystal structure of a DARPin protein
Authors:Ngo, K.H., Liew, C.W., Heddi, B., Phan, A.T.
Deposition date:2023-03-14
Release date:2024-09-18
PDBID:8io0
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Cryo-EM structure of human HCN3 channel with cAMP
Authors:Yu, B., Lu, Q.Y., Li, J., Zhang, J.
Deposition date:2023-03-10
Release date:2024-08-10
PDBID:8io1
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Cryo-EM structure of human HCN3 channel with PIP2
Authors:Yu, B., Lu, Q.Y., Li, J., Zhang, J.
Deposition date:2023-03-10
Release date:2024-08-10
PDBID:8ikn
Status:HOLD -- hold until a certain date
Title:S3.11-T-box in complex with WT Mycobacterium smegmatis isoleucine tRNA
Authors:Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, K., Wei, X.W., Yang, Y., Henkin, T.M., Su, Z.
Deposition date:2023-02-28
Release date:2024-08-28
PDBID:8ikk
Status:HOLD -- hold until a certain date
Title:Mycobacterium smegmatis ileS T-box RNA in complex with its cognate tRNA
Authors:Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, M., Wei, X., Yang, Y., Henkin, T.M., Su, Z.
Deposition date:2023-02-28
Release date:2024-08-28
PDBID:8iki
Status:HOLD -- hold until a certain date
Title:Mycobacterium smegmatis ileS T-box RNA in complex with acc.11-tRNA
Authors:Jia, X., Luo, B., Su, Z.
Deposition date:2023-02-28
Release date:2024-08-28
PDBID:8iko
Status:HOLD -- hold until a certain date
Title:S3.11-T-box in complex with acc.11-tRNA
Authors:Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, M., Wei, X., Yang, Y., Henkin, T.M., Su, Z.
Deposition date:2023-02-28
Release date:2024-08-28
PDBID:8g4i
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:40S ribosomal subunit of the 80S Giardia intestinalis assemblage A ribosome with Emetine bound in V1 conformation
Authors:Eiler, D.R., Wimberly, B.T., Bilodeau, D.Y., Rissland, O.S., Kieft, J.S.
Deposition date:2023-02-09
PDBID:8g4b
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal structure of heterodimeric Crotoxin B from Crotalus durissus collilineatus
Authors:Salvador, G.H.M., Borges, R.J., Fontes, M.R.M.
Deposition date:2023-02-09
PDBID:8fpa
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of a chimeric antibody (Fab) fragment bound to de-N-acetyl polysialic acid (dPSA)
Authors:Beernink, P.T., Agirre, J., Beernink, B.P., Moe, G.R.
Deposition date:2023-01-04
Release date:2024-07-19

222415

数据于2024-07-10公开中

PDB statisticsPDBj update infoContact PDBjnumon