| PDBID: | 9qx6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of RXR alpha LBD bound to a synthetic agonist FN537 and a coactivator fragment | | Authors: | Morozov, V., Merk, D., Nawa, F. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxm | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with DMJ | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uhk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the catalytic domain of USP7 bound to a hPiT1 peptide | | Authors: | Wang, S.-C., Sun, Y.-J. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6p | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro S113C in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6q | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro L115A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o72 | | Status: | HPUB -- hold until publication | | Title: | Structure of turkey hemoglobin A covalently bound with epigallocatechin gallate | | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o70 | | Status: | HPUB -- hold until publication | | Title: | Motif1-Motif2, two domain left-handed parallel G-quadruplex | | Authors: | Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o74 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro L115M in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw9 | | Status: | HPUB -- hold until publication | | Title: | Human vault protein - primed conformation | | Authors: | Lapenta, F., Marechal, N., Durand, A., Aupic, J., Cassetta, A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepIII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepII-HepI-PhosI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic PhosII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qwl | | Status: | HPUB -- hold until publication | | Title: | Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343 | | Authors: | Sauer, U.H., Cisneros, D.A. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
(MSE)AFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILEN(MSE)TNQFKPHSGSIVFKKGDEEAK(MSE)KELTWENGYITEFTENIDIVGSQP(MSE)TITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH
|
|
| PDBID: | 9qw5 | | Status: | HPUB -- hold until publication | | Title: | Urate Oxidase from Aspergillus Flavus with its Inhibitor 9-Methyl Uric Acid by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw6 | | Status: | HPUB -- hold until publication | | Title: | Urate Oxidase from Aspergillus Flavus with its Substrate Uric Acid by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6e | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro S10C in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6f | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro S113A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvy | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw0 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose and Bis-Tris | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw1 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6d | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro S10A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qvw | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme native | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9qv9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | apPol-DNA-nucleotide complex (ternary 3) | | Authors: | Lahiri, I., Kumari, A. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9o6a | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of EcKatG S-Trp105 at 2.22 Angstrom resolution revealing an asymmetric sulfur center in O=S-Trp | | Authors: | Duan, R., Li, J., Liu, A., Nathan, B., Yang, X. | | Deposition date: | 2025-04-11 |
|
