Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9q9c
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-26
PDBID:9q9d
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-26
PDBID:9q9g
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D10
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-26
PDBID:9nhy
Status:HPUB -- hold until publication
Title:Fab1502 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9ni1
Status:HPUB -- hold until publication
Title:Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9ni2
Status:HPUB -- hold until publication
Title:Fab369 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9q8r
Status:HPUB -- hold until publication
Title:Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor
Authors:Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C.
Deposition date:2025-02-25
Sequence:

>Entity 1


GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
PDBID:9q8t
Status:HPUB -- hold until publication
Title:Nociceptive properties of U5-theraphotoxin-Hs1b, a novel peptide from the Cyriopagopus schmidti spider, active on NaV1.7 channel
Authors:Meudal, H., Landon, C.
Deposition date:2025-02-25
PDBID:9q8q
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNKK2A2 gene product) in complex with F2X-Entry screen fragment E03
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-25
PDBID:9q8s
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment A11
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-25
PDBID:9q8x
Status:HPUB -- hold until publication
Title:Ku70/80 bound to a 153 bp H2AX nucleosome
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-02-25
PDBID:9nhi
Status:HPUB -- hold until publication
Title:AMC016 v4.2 in complex with Base-C pAb isolated from animal RQk18 at week 43
Authors:Pratap, P.P., Ozorowski, G., Ward, A.B.
Deposition date:2025-02-24
Sequence:

>Entity 1


(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)W(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)W(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)

>Entity 2


(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)W(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)F(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)

>Entity 3


MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARAEEELWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHCCVPTDPSPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTDLGNATDAINRNTTDAPNSTLRTMEEKGEIKNCSFNITTSVRDKMQKEYATFYKLDIVPIDNDNNSYRLINCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENFTDNGKTIIVQLNESVEINCTRPNNNTRKSIHIGPGRAFYTTGQIIGNIRQAHCNISRAKWNNTLHKIVKKLREQFRNKTIVFKQSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWYGNESSDNPGVEGNITLPCRIKQIINLWQEVGKAMYAPPIGGQIRCSSNITGLLLTRDGGNNNITTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKCKRRVVQRRRRRR

>Entity 4


AVGIGAVFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQSNLLRAPECQQHLLKDTHWGIKQLQARVLAVEHYLKDQQLLGIWGCSGKLICTTAVPWNATWSNKTLDNIWNNMTWMEWEKEISNYTNLIYNLIEESQNQQEKNETENLTLC
PDBID:9lyv
Status:HPUB -- hold until publication
Title:structure of prrx bound to DNA
Authors:Dong, C., Yan, X.J., Guo, S.M., Huang, Y.L.
Deposition date:2025-02-21
PDBID:9lyu
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica (Ligand-free form)
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lyx
Status:HPUB -- hold until publication
Title:hCTPS1 with CTP and DON
Authors:Guo, C.J., Bao, X.J., Liu, J.L.
Deposition date:2025-02-21
Sequence:

>Entity 1


MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
PDBID:9lyy
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with ADP and G3P.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lzg
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with daphnetin.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lzi
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with GK-butyl.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9ihi
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNKK2A2 gene product) in complex with F2X-Entry screen fragment D02 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-21
PDBID:9ihg
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNKK2A2 gene product) in complex with F2X-Entry screen fragment C02
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-21
PDBID:9lyn
Status:AUTH -- processed, waiting for author review and approval
Title:The electron diffraction structure of photosensitizer protein PSP2
Authors:Zhao, Y.M., Qi, C.
Deposition date:2025-02-20
PDBID:9lys
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of de novo designed amantadine binding homotrimer dAIT03
Authors:Qihan, J., Longxing, C.
Deposition date:2025-02-20
PDBID:9nf2
Status:HPUB -- hold until publication
Title:KRAS G12D Mutant KRAS 1-169 at 298 K bound to MRTX-1133 and GMPPNP
Authors:Xu, M., Deck, S.L., Milano, S.K., Aplin, C., Cerione, R.A.
Deposition date:2025-02-20
PDBID:9igw
Status:HPUB -- hold until publication
Title:Ku70/80 bound to 147 bp nucleosome
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-02-20
PDBID:9igx
Status:HPUB -- hold until publication
Title:Ku70/80 bound to 153 bp nucleosome
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-02-20

237735

数据于2025-06-18公开中

PDB statisticsPDBj update infoContact PDBjnumon