| PDBID: | 9s9g | | Status: | HPUB -- hold until publication | | Title: | S. islandicus CdvA filament (X-ray) | | Authors: | Salzer, R., Lowe, J., Bellini, D. | | Deposition date: | 2025-08-06 | | Sequence: | >Entity 1
MPVSYEVLTKFIGQKVKDIYGREFGYLIHVYSEIDGSITGIEVAQGSSILTMGPERIKLDGDSILILPDWKAEAIRILSLMEKIRKRQRALEELYNKQEIPKSDYDDMKRKLDTEMLKVKDDQNKLKGKLKSRLNDIEDQLAHIDKAVISLKMSYISSEIPENAYKGSMEVLRQSKDSYTLERDDIRKTLDRLDSLDKESIELKPLGSLSTSQQGEAKSDQSKSEIPLPIPVKVINTL
|
|
| PDBID: | 9s9i | | Status: | HPUB -- hold until publication | | Title: | S. islandicus CdvA (non-polymerising mutant) | | Authors: | Salzer, R., Lowe, J., Bellini, D. | | Deposition date: | 2025-08-06 | | Sequence: | >Entity 1
MPVSYEVLTKFIGQKVKDIYGREFGYLIHVYSEIDGSITGIEVAQGSSILTMGPERIKLDGDSILILPDWKAEAIRILSLMEKIRKRQRDLEEDYNKQEDPKSDYDDMKRKLDTEMLKVKDDQNKLKGKLKSRLNDIEDQLAHIDKAVDSLKDSYDSSEIPENAYKGSMEVLRQSKDSYTLERDDIRKTLDRLDSLDKESIELKPLGSLSTSQQGEAKSDQSKSEIPLPIPVKVINTL
|
|
| PDBID: | 9pxe | | Status: | HPUB -- hold until publication | | Title: | JRFL.TD15 membrane Env liposome in complex with CH103.H17L8 Fab | | Authors: | Karlinsey, D.C., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s7x | | Status: | HPUB -- hold until publication | | Title: | Amuc0121_S1_15 in complex with D-Galactose | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s85 | | Status: | HPUB -- hold until publication | | Title: | Amuc0121_S1_15 in complex with O6 sulfated D-Galactose | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s88 | | Status: | HPUB -- hold until publication | | Title: | Amuc0121_S1_15 in complex with O6 sulfated Lewis A antigen (6''S-LeA) | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s8a | | Status: | HPUB -- hold until publication | | Title: | Amuc0451_S1_20 | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s8f | | Status: | HPUB -- hold until publication | | Title: | Amuc1755_S1_16 in complex with D-Galactose | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s8y | | Status: | PROC -- to be processed | | Title: | Amuc1074_S1_11 in complex with N-acetyl D-glucosamine | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s8x | | Status: | HPUB -- hold until publication | | Title: | Amuc0953_S1_20 in complex with D-Galactose | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9pwk | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | P21A Mutant of E. coli Dihydrofolate Reductase Complexed with Folate and Nicotinamide Adenine Dinucleotide Phosphate (oxidized form) | | Authors: | Fried, S.D.E., Mathews, I.I., Boxer, S.G. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9pwm | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Dihydrofolate Reductase Complexed with Folate and Nicotinamide Adenine Dinucleotide Phosphate (Oxidized Form) | | Authors: | Fried, S.D.E., Mathews, I.I., Boxer, S.G. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9pwb | | Status: | HPUB -- hold until publication | | Title: | Structure of AP-2 bound to the dileucine motif of CCDC32; combined map | | Authors: | Baker, R.W., Kikkawa, M., Sloan, D.E., Yanagisawa, H. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6b | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF A CYP168A1 | | Authors: | Li, Q., Liu, W.D., Tang, H.Z., Huang, L., Cheng, Z.Y., Xu, P. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9s7m | | Status: | HPUB -- hold until publication | | Title: | HIV-1 capsid (M-group) - native in complex with JW3-093 | | Authors: | Govasli, M.A.L., Pinotsis, N., Towers, G., Selwood, D., Jacques, D.A. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9s7j | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM (200kV) structure of pyruvate decarboxylase from Neoasaia chiangmaiensis | | Authors: | van Rooyen, J.M., Barker, I., Fruncillo, S., Pandya, A., Ozkaya, D., Alcasabas, A. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9pvx | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with dA at +1 site, 8-oxo-GTP bound in E-site. | | Authors: | Hou, P., Oh, J., Wang, D. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pvu | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with dC at +1 site, 8-oxo-GMP added. | | Authors: | Hou, P., Oh, J., Wang, D. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pvv | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with dC at +1 site, 8-oxo-GTP bound in A-site. | | Authors: | Hou, P., Oh, J., Wang, D. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pvw | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with dA at +1 site, 8-oxo-GMP added in Syn-conformation | | Authors: | Hou, P., Oh, J., Wang, D. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pv8 | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of the oligopeptide-binding protein OppA3 from Borrelia burgdorferi | | Authors: | Dasteh Goli, K., Kataria, A., Gittis, A.G., Garboczi, D.N., Groshong, A.M. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9w4v | | Status: | HPUB -- hold until publication | | Title: | Structure of transcription factor in complex with D-allo-Ile | | Authors: | Sakuraba, H., Ohshima, T., Yoneda, K. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9s6j | | Status: | HPUB -- hold until publication | | Title: | HIV-1 capsid (M-group) - CPSF6 | | Authors: | Govasli, M.A.L., Pinotsis, N., Towers, G., Selwood, D., Jacques, D.A. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9s6v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HIV-1 capsid (M-group) - native in complex with JW3-094 | | Authors: | Govasli, M.A.L., Pinotsis, N., Towers, G., Selwood, D., Jacques, D.A. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9s6d | | Status: | HPUB -- hold until publication | | Title: | The role of LLPS in yeast Clathrin-mediated endocytosis and trafficking | | Authors: | Ruiz-Carrillo, D., Garcia-Alai, M., Defelipe, L. | | Deposition date: | 2025-07-31 |
|
