| PDBID: | 9m2t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with AMP-PNP and glycerol. | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9m36 | | Status: | HPUB -- hold until publication | | Title: | Structure of human TRPC5 in the low Ca environment. | | Authors: | Song, K.C., Wei, M., Chen, L. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9njw | | Status: | HPUB -- hold until publication | | Title: | Structure of ancestral-reconstructed cytochrome P450 11A1 (CYP11A1) in complex with cholesterol | | Authors: | Chagas, B.C., Wang, P.C., Brixius-Anderko, S. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qao | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin-1 converting enzyme C-domain in complex with trandolaprilat | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qap | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin-1 converting enzyme C-domain in complex with quinaprilat | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qaq | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin-1 converting enzyme C-domain in complex with perindoprilat | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qab | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment E11 and CX-4945 (Silmitasertib) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qag | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment FF08 and CX-4945 (Silmitasertib) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qah | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G04 and CX-4945 (Silmitasertib) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qak | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G07 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qb6 | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H02 and CX-4945 (Silmitasertib) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qb0 | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H07 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qam | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin-1 converting enzyme C-domain in complex with ciprofloxacin | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9m2a | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the trypanosome alternative oxidase complexed with a trypanocidal phosphonium derivative (compound1) | | Authors: | Ebiloma, G.U., Balogun, E.O., Dardonville, C., De Koning, H.P., Shiba, T. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9njm | | Status: | HPUB -- hold until publication | | Title: | hMCT1-BSGiso2-INX444 | | Authors: | Lo, Y.-H., Dorsey, F.C. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9m20 | | Status: | HPUB -- hold until publication | | Title: | GmMAN19-1 from Glycine max | | Authors: | Lin, C.J., Hsu, C.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m21 | | Status: | HPUB -- hold until publication | | Title: | GmMAN19-1 from Glycine max in complex with mannopentaose | | Authors: | Lin, C.J., Hsu, C.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of N-prenyltransferase DsKabA | | Authors: | Huang, W.J., Hsu, C.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1y | | Status: | HPUB -- hold until publication | | Title: | NMR Structure of Mouse Keratin 17 Tail Domain (G390 - R433) in solution | | Authors: | Yeom, J., Lee, C.H., Kim, J.H. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GSTGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR
|
|
| PDBID: | 9niw | | Status: | HPUB -- hold until publication | | Title: | Fab1550 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9niy | | Status: | HPUB -- hold until publication | | Title: | Fab1393 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj4 | | Status: | HPUB -- hold until publication | | Title: | Fab1437 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q99 | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment B06 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9t | | Status: | HPUB -- hold until publication | | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9q9b | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment C07 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
