| PDBID: | 9ugk | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Rv0866 from Mycobacterium tuberculosis | | Authors: | Cho, H.J., Kang, B.S. | | Deposition date: | 2025-04-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9qux | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the Homer1 EVH1 domain | | Authors: | Czajlik, A., Maruzs, B., Fanni, F., Batta, G., Gaspari, Z., Peterfia, B.F. | | Deposition date: | 2025-04-11 | | Sequence: | >Entity 1
GSHMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQ
|
|
| PDBID: | 9qv4 | | Status: | HPUB -- hold until publication | | Title: | 1-Phosphofructokinase mutant K95T/G110S from E. coli with bound fructose-1,6-bisphosphate and ADP | | Authors: | Zarzycki, J., Dronsella, B., Erb, T.J., Lindner, S.N. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9o6a | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of EcKatG S-Trp105 at 2.22 Angstrom resolution revealing an asymmetric sulfur center in O=S-Trp | | Authors: | Duan, R., Li, J., Nathan, B., Yang, X., Liu, A. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9ug5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HA3 from Clostridium botulinum type B with alpha2,3-sialyllactose | | Authors: | Amatsu, S., Kitadokoro, K. | | Deposition date: | 2025-04-11 | | Sequence: | >Entity 1
MASWSHPQFEKGALEVLFQGPGYQYSDTIDLADGNYVVSRGDGWILSRQNQILGGSVISNGSTGIVGDLRVNDNAIPYYYPTPSFNEEYIKNNIQTVFANFTEANQIPIGFEFSKTAPSNKNLYMYLQYTYIRYEIIKVLQHEIIERAVLYVPSLGYVKSIEFNPGEKINKDFYFLTNDKCILNEQFLYKKILETTKNIPTNNIFNSKVSSTQRVLPYSNGLYVINKGDGYIRTNDKDLIGTLLIEAGSSGSIIQPRLRNTTRPLFTTSNDAKFSQQYTEERLKDAFNVQLFNTSTSLFKFVEEAPSNKNICIKAYNTYEKYELIDYQNGSIVNKAEYYLPSLGYCEVTNAPSPESEVVKTQVAEDGFIQNGPEEEIVVGVIDPSENIQEINTAISDNYTYNIPGIVNNNPFYILFTVNTTGIYKINAQNNLPSLKIYEAIGSGNRNFQSGNLCDDDIKAINYITGFDSPNAKSYLVVLLNKDKNYYIRVPQTSSNIENQIKFKREEGDLRNLMNSSVNIIDNLNSTGAHYYTRQSPDVHDYISYEFTIPGNFNNKDTSNIRLYTSYNQGIGTLFRVTETIDGYNLINIQQNLNLLNSTKSIRLLNGAIYILKVEVTELNNYNIKLHIDITN
|
|
| PDBID: | 9ug6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HA3 from Clostridium botulinum type B with alpha2,6-sialyllactose | | Authors: | Amatsu, S., Kitadokoro, K. | | Deposition date: | 2025-04-11 | | Sequence: | >Entity 1
MASWSHPQFEKGALEVLFQGPGYQYSDTIDLADGNYVVSRGDGWILSRQNQILGGSVISNGSTGIVGDLRVNDNAIPYYYPTPSFNEEYIKNNIQTVFANFTEANQIPIGFEFSKTAPSNKNLYMYLQYTYIRYEIIKVLQHEIIERAVLYVPSLGYVKSIEFNPGEKINKDFYFLTNDKCILNEQFLYKKILETTKNIPTNNIFNSKVSSTQRVLPYSNGLYVINKGDGYIRTNDKDLIGTLLIEAGSSGSIIQPRLRNTTRPLFTTSNDAKFSQQYTEERLKDAFNVQLFNTSTSLFKFVEEAPSNKNICIKAYNTYEKYELIDYQNGSIVNKAEYYLPSLGYCEVTNAPSPESEVVKTQVAEDGFIQNGPEEEIVVGVIDPSENIQEINTAISDNYTYNIPGIVNNNPFYILFTVNTTGIYKINAQNNLPSLKIYEAIGSGNRNFQSGNLCDDDIKAINYITGFDSPNAKSYLVVLLNKDKNYYIRVPQTSSNIENQIKFKREEGDLRNLMNSSVNIIDNLNSTGAHYYTRQSPDVHDYISYEFTIPGNFNNKDTSNIRLYTSYNQGIGTLFRVTETIDGYNLINIQQNLNLLNSTKSIRLLNGAIYILKVEVTELNNYNIKLHIDITN
|
|
| PDBID: | 9o5p | | Status: | HPUB -- hold until publication | | Title: | Structure of ClpC1-NTD complexed with Diterpene B (GRDN0001) | | Authors: | Ratia, K., Lee, H., Abad-Zapatero, C. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5j | | Status: | HPUB -- hold until publication | | Title: | Human Aconitate Decarboxylase I apo form | | Authors: | Runge, B.R., Monteiro, D.C.F. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5n | | Status: | HPUB -- hold until publication | | Title: | Human Aconitate Decarboxylase I bound to citraconate | | Authors: | Runge, B.R., Monteiro, D.C.F. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5r | | Status: | HPUB -- hold until publication | | Title: | VAR2CSA in complex with V2C.044 Fab | | Authors: | Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufo | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the asymmetrically reconstructed phage T4 capsid-neck-tail complex | | Authors: | Shao, Q., Dong, J., Wang, A., Li, L., Zheng, Y., Li, H., Li, Y., Zhang, Q., Sun, L., Fokine, A., Rao, V.B., Tao, P., Fang, Q. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 |
|
| PDBID: | 9ufc | | Status: | HOLD -- hold until a certain date | | Title: | Structural of a glutamate cysteine ligase StGSH1 in Solanum tuberosum | | Authors: | Zhao, H.B., Fan, S.L. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 |
|
| PDBID: | 9qtf | | Status: | HPUB -- hold until publication | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 C256A catalytically inactive mutant | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtg | | Status: | HPUB -- hold until publication | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 in complex with hsSUMO1 | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qte | | Status: | HPUB -- hold until publication | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 wildtype | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9ue4 | | Status: | HPUB -- hold until publication | | Title: | Serine Beta-Lactamase OXA-48 in Complex with MBL/SBL Inhibitor FB3-2 | | Authors: | Li, G.-B., Wei, S.-Q. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9ueh | | Status: | HPUB -- hold until publication | | Title: | Serine Beta-Lactamase OXA-48 in Complex with MBL/SBL Inhibitor FB1-10 | | Authors: | Li, G.-B., Wei, S.-Q. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9uem | | Status: | HPUB -- hold until publication | | Title: | Metallo-Beta-Lactamase VIM-2 in Complex with MBL/SBL Inhibitor FB1-12 | | Authors: | Li, G.-B., Wei, S.-Q. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qsw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an NtA622L variant in complex with NADP+ and Nicotinic acid | | Authors: | Mokos, D., Daniel, B. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9ud7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human glutaminyl cyclase in complex with Inhibitor CL7 | | Authors: | Li, G.-B., Ning, X.-L., Meng, F.-B., Chen, Y.-T. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9qsm | | Status: | HPUB -- hold until publication | | Title: | small molecule inhibitor in complex with PD-L1 | | Authors: | Muszak, D., Kocik-Krol, J., Zaber, J., Kruc, O., Palej, U., Fijolkowska, K., Maslanka, A., Magiera-Mularz, K., Plewka, J., Stec, M., Siedlar, M., Musielak, B., Kitel, R., Skalniak, L., Surmiak, E. | | Deposition date: | 2025-04-05 |
|
| PDBID: | 9qs4 | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrq | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qr6 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the tetrahedral M42 aminopeptidase from M. jannaschii | | Authors: | Atalah, J., Basbous, H., Girard, E., Effantin, E., Schoehn, G., Franzetti, B. | | Deposition date: | 2025-04-03 |
|
