| PDBID: | 9x2l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9x2m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9x2n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | JP Complex - E. coli MurJ, Levivirus PP7 lysis protein SglPP7 | | Authors: | Kohga, H., Hosoda, K., Tsukazaki, T. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yka | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of post-fusion EBV gB in complex with AMMO2 fab | | Authors: | Chou, C.W., McCool, R.S., McLellan, J.S. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9ykc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yjz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk1 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk3 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with complementary RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
CGACAU
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk4 | | Status: | PROC -- to be processed | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk5 | | Status: | HPUB -- hold until publication | | Title: | 100K X-ray structure of mixed metal D132N Bacillus halodurans RNase H1 complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk7 | | Status: | PROC -- to be processed | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K595 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9ykd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K569 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk8 | | Status: | PROC -- to be processed | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9swf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9swg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9swi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the small alarmone hydolase (SAH) of 201phi2-1 phage | | Authors: | Jalomo-Khayrova, E., Pane-Farre, J., Bange, G. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9swd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9swh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9swe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9x2h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | AARS1 bound with XY353 | | Authors: | Yunyuan, H., Siying, L., Jinrong, M. | | Deposition date: | 2025-10-05 | | Release date: | 2026-10-05 |
|
| PDBID: | 9x2i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | AARS1 bound with XY353-1 | | Authors: | Yunyuan, H., Siying, L., Jinrong, M. | | Deposition date: | 2025-10-05 | | Release date: | 2026-10-05 |
|
