| PDBID: | 8qn1 | | Status: | HPUB -- hold until publication | | Title: | OPR3 variant - R283D | | Authors: | Bijelic, A., Macheroux, P., Kerschbaumer, B. | | Deposition date: | 2023-09-25 | | Sequence: | >Entity 1
NPLFSPYKMGKFNLSHRVVLAPMTRCRALNNIPQAALGEYYEQRATAGGFLITEGTMISPTSAGFPHVPGIFTKEQVREWKKIVDVVHAKGAVIFCQLWHVGRASHEVYQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGADRVGVRVSPAIDHLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPDYVAYGQTEAGRLGSEEEEARLMRTLRNAYQGTFICSGGYTRELGIEAVAQGDADLVSYGRLFISNPDLVMRIKLNAPLNKYNRKTFYTQDPVVGYTDYPFL
|
|
| PDBID: | 8ubq | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-24 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8uaw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of Brucella Abortus Lumazine Synthase (BLS) Engineered with Shiga Toxin II subunit B (Stx2B) | | Authors: | Cristofalo, A.E., Sharma, A., Cerutti, M.L., Sharma, K., Zylberman, V., Goldbaum, F.A., Borgnia, M.J., Otero, L.H. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub5 | | Status: | HPUB -- hold until publication | | Title: | The Apo NanH structure from Clostridium perfringens | | Authors: | Medley, B.J., Boraston, A.B. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8qmb | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Nucleant-assisted 2.0 A resolution structure of the Streptococcus pneumoniae topoisomerase IV-V18mer DNA complex with the novel fluoroquinolone Delafloxacin | | Authors: | Najmudin, S., Pan, X.S., Wang, B., Cheyen, N.E., Fisher, L.M., Sanderson, M.R. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8qmc | | Status: | HOLD -- hold until a certain date | | Title: | High resolution structure of the Streptococcus pneumoniae topoisomerase IV-complex with the V-site 18mer dsDNA and novel fluoroquinolone Delafloxacin | | Authors: | Najmudin, S., Pan, X.S., Wang, B., Chayen, N.E., Fisher, L.M., Sanderson, M.R. | | Deposition date: | 2023-09-21 | | Release date: | 2024-09-21 |
|
| PDBID: | 8qku | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SWR1-nucleosome complex in configuration 1 | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-09-18 | | Release date: | 2024-09-18 |
|
| PDBID: | 8qkv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SWR1-nucleosome complex in configuration 2 | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-09-18 | | Release date: | 2024-09-18 |
|
| PDBID: | 8wd9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis DppABCD in apo form | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8wda | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the substrate-bound DppABCD complex | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8wdb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the ATP-bound DppABCD complex | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u5w | | Status: | HPUB -- hold until publication | | Title: | De novo designed pentameric helical bundle protein | | Authors: | Bick, M.J., Xu, C., Sankaran, B., Baker, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome domain 1 from PgcA | | Authors: | Nash, B.W., Edwards, M.J., Clarke, T.A. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5o | | Status: | HPUB -- hold until publication | | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u59 | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-12 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8qi0 | | Status: | HPUB -- hold until publication | | Title: | 340A Vipp1 H1-6 helical tubes | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u52 | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human transthyretin conjugated to the stilbene substructure derived from reaction with the fluorogenic covalent kinetic stabilizer A2 | | Authors: | Yan, N.L., Nugroho, K., Kline, G.M., Basanta, B., Lander, G.C., Wilson, I.A., Kelly, J.W. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8wa4 | | Status: | HPUB -- hold until publication | | Title: | Solution structure of free ATF4 promoter G-quadruplex | | Authors: | Liu, Y.S., Wang, K.B. | | Deposition date: | 2023-09-07 |
|
| PDBID: | 8u1y | | Status: | HPUB -- hold until publication | | Title: | E.coli DsbA in complex with N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-04 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8w7w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of d(CGTATACG)2 with acridine complex | | Authors: | Huang, S.C., Satange, R.B., Hou, M.H. | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8w7c | | Status: | HPUB -- hold until publication | | Title: | Activation of mitochondrial Caseinolytic Protease P (ClpP) induces selective cancer cell lethality | | Authors: | Jiang, J.-X., Ding, H., Lu, M.-L., Chen, M.-R., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8w7e | | Status: | HPUB -- hold until publication | | Title: | Design, synthesis and biological evaluations of novel small molecular hyper-activators of human caseinolytic peptidase P (hClpP) | | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8w7g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome P450 CYP161H12 from Amycolatopsis pretoriensis | | Authors: | Dong, L.B., Zhang, X.W., Pan, X.M., Li, F.R. | | Deposition date: | 2023-08-30 | | Sequence: | >Entity 1
HHHHHHMTTTEETPRLPFARANALAIAPDYEVLRSRAPISRVLTPAGDPAWLVTSYEEAKEVFRDKRFGRSHPAPEQASRISNAAIQDGPSGDFETEEAEHKRMRRMLAPAFSAPRMRALGDRIAELTDRCLDDLQAAHDANPGAPVDLTDFLAFPLPVLVICELLGVPYADREHFRGLSERIARMDGGEDAQAAMAEFKAYMLKLAEAKRADPQPDVISDLVAVQADDPTFTDDDLSRMATGLLFAGHETTSTRIAMGTLFLLSDTARRDRFAADPDGEVNQTVEEILRLTATSGTGLLRYAHEDVEIAGTRIRRGDAVLVSSDAANRDASVFADPDEFDPGRTPNVHLAFGTGAHVCIGANLARTELRTVFPKLFRRFPGLRLAAGIEDVPVRVNRVAGGVDAVPVTWHHHHHH
|
|
| PDBID: | 8w76 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of d(CGTATACG)2 duplex | | Authors: | Satange, R.B., Peng, C.L., Hou, M.H. | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8u0r | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of protein A21, a component of the conserved poxvirus entry-fusion complex | | Authors: | Diesterbeck, U., Gittis, A.G., Garboczi, D.N., Moss, B. | | Deposition date: | 2023-08-29 |
|
