| PDBID: | 9r2s | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of the S.aureus ClpP degradation chamber in the context of the MecA/ClpC/CLpC complex | | Authors: | Azinas, S., Wallden, K., Katikaridis, P., Schahl, A., Mogk, A., Carroni, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9urf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of beta-glucosidase from Bacteroides ovatus | | Authors: | Kumar, A.K., Jamdar, S.N., Sarver, R., Makde, R.D. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9urg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of beta-glucosidase from Bacteroides ovatus bound to beta-D-Glucose | | Authors: | Kumar, A.K., Jamdar, S.N., Sarver, R., Makde, R.D. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9urd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zinc-binding metallopeptidase (Uniprot: A0AAN3A8D2) from Bacteroides ovatus | | Authors: | Kulkarni, B.S., Kumar, A.K., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of4 | | Status: | HPUB -- hold until publication | | Title: | Structure of the Acinetobacter baumannii Response Regulator PmrA Receiver Domain M12I Mutation | | Authors: | Jaimes, F.E., Milton, M.E., Hondros, A.D., Cavanagh, J. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9oex | | Status: | HPUB -- hold until publication | | Title: | K-Ras G12V at 293 K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofa | | Status: | HPUB -- hold until publication | | Title: | The structure of a Fungal Cyanide Hydratase from Gloeocercospora sorghi | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Farah, C.S. | | Deposition date: | 2025-04-29 | | Sequence: | >Entity 1
MPINKYKAAVVTSEPVWENLEGGVVKTIEFINEAGKAGCKLIAFPEVWIPGYPYWMWKVNYLQSLPMLKAYRENSIAMDSSEMRRIRAAARDNQIYVSIGVSEIDHATLYLTQVLISPLGDVINHRRKIKPTHVEKLVYGDGSGDSFEPVTQTEIGRLGQLNCWENMNPFLKSLAVARGEQIHVAAWPVYPDLSKQVHPDPATNYADPASDLVTPAYAIETGTWVLAPFQRISVEGLKRHTPPGVEPETDATPYNGHARIFRPDGSLYAKPAVDFDGLMYVDIDLNESHLTKALADFAGHYMRPDLIRLLVDTRRKELVTEVGGGDNGGIQSYSTMARLGLDRPLEEEDYRQGTDAGETEKASSNGHA
|
|
| PDBID: | 9r21 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the flotillin-associated rhodopsin PsFAR in detergent micelle | | Authors: | Kovalev, K., Stetsenko, A., Marin, E., Guskov, A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r22 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the light-driven proton pump PsPR in detergent micelle | | Authors: | Kovalev, K., Stetsenko, A., Guskov, A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r23 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the double mutant H84V/E120G of the flotillin-associated rhodopsin PsFAR in detergent micelle | | Authors: | Kovalev, K., Stetsenko, A., Guskov, A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r2c | | Status: | HPUB -- hold until publication | | Title: | CpKRS in complex with inhibitor DDD01038762 | | Authors: | Dawson, A., Baragana, B., Robinson, D.A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9upi | | Status: | HPUB -- hold until publication | | Title: | Entamoeba histolytica Cyclophilin 18 in complex with Cyclosporin A | | Authors: | Gandhi, S., Vasudevan, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oef | | Status: | HPUB -- hold until publication | | Title: | Structure of the human astrovirus VA1 capsid spike bound to antibody 7C8 | | Authors: | Ghosh, A., Dzimianski, J.V., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oeg | | Status: | HPUB -- hold until publication | | Title: | Structure of the human astrovirus VA1 capsid spike bound to antibody 2A2 | | Authors: | Ghosh, A., Dzimianski, J.V., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9odt | | Status: | HPUB -- hold until publication | | Title: | The structure of a Bacterial Cyanide Dihydratase from Bacillus safensis PER-URP-08 | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Chuck, C.S. | | Deposition date: | 2025-04-27 | | Sequence: | >Entity 1
MTSIYPKFRAAAVQAAPVYLNLEATVEKSCELIDEAASNGAKLVAFPEAFLPGYPWFAFIGHPEYTRKFYHELYKNAVEIPSLAIQKISEAAKRNETYVCISCSEKDGGSLYLAQLWFNPNGDLIGKHRKMRASVAERLIWGDGSGSMMPVFQTDIGNLGGLMCWEHQVPLDLMAMNAQNEQVHVASWPGYFDDEISSRYYAIATQTFVLMTSSIYTEEMKEMICLTQEQRDYFETFKSGHTCIYGPDGEPISDMVPAETEGIAYAEIDVERVIDYKYYIDPAGHYSNQSLSMNFNQQPTPVVKQLYHQKNEVFTYEDIQYQHGILEEKV
|
|
| PDBID: | 9ocw | | Status: | HPUB -- hold until publication | | Title: | A constitutively active construct of eukaryotic elongation factor 2 kinase | | Authors: | Piserchio, A., Long, K., Isiorho, E.A., Dalby, K., Ghose, R. | | Deposition date: | 2025-04-25 |
|
| PDBID: | 9od2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of modified Zika virus E protein dimer complexed with a neutralizing antibody SMZAb2 Fab | | Authors: | Galkin, A., Pozharski, E. | | Deposition date: | 2025-04-25 |
|
| PDBID: | 9r17 | | Status: | HPUB -- hold until publication | | Title: | De novo designed homodimeric NTF2-like protein with a hydrophobic pocket | | Authors: | Nadal, M., Marcos, E. | | Deposition date: | 2025-04-25 |
|
| PDBID: | 9unt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of UPF0235 protein PF1765 from Pyrococcus furiosus | | Authors: | Yadav, B., Gaikwad, S.S., Kumar, A., Chandravanshi, K., Makde, R.D. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9ocn | | Status: | HPUB -- hold until publication | | Title: | PC68_L31_570 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | | Authors: | Ozorowski, G., Torres, J.L., Ward, A.B. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9ocp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OsSULTR3;6 transporter from rice (Oryza sativa) | | Authors: | Young, M.A., Shi, X., Scinto-Madonich, N., Tsai, Y.T., Baruah, S., Cheng, L., Bi, Y., Stowell, M., Bogdanove, A.J., Pineros, M., Chang, G. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r11 | | Status: | HPUB -- hold until publication | | Title: | Structure of the PRYSPRY domain of human MID2, crystal form II | | Authors: | Munoz Sosa, C.J., Zhubi, R., Chaikuad, A., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glutathione transferase iota 1 from Synechocystis sp. PCC 6803 in complex with FMN | | Authors: | Didierjean, C., Hecker, A., Morette, L. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r00 | | Status: | HPUB -- hold until publication | | Title: | De novo NTF2-like protein with a 2-helix C-terminal extension. | | Authors: | Nadal, M., Marcos, E., Castellvi, A. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | De novo designed homodimeric NTF2-like protein with a hydrophobic pocket | | Authors: | Nadal, M., Marcos, E. | | Deposition date: | 2025-04-24 |
|
