PDBID: | 9i42 | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-2D Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i3w | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-8C Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i43 | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-9D Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i3x | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-11B Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i3z | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-12D Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i41 | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-3C Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i40 | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-4D Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i45 | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-10B Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 | Sequence: | >Entity 1 QSALTQPASVSGSPGQSITISCTGTSSIFGSYYLVSWYQQYPGKAPKLIVYEGSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEAAYYCCSYAGTRTYVFGTGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADKSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
>Entity 2 EVQLVQSGSELKKPGASVKVSCKVSRSTFVNYAVNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLLISGLKADDSAVYYCAYDPLGNWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKHHHHHH
|
|
PDBID: | 9i4c | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 17-1-12A Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i4d | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-2B Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i4b | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-12A Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9i4e | Status: | HPUB -- hold until publication | Title: | Structure of anti-EV71 human monoclonal antibody 34-1-6D Fab | Authors: | Zhou, D., Ren, J., Stuart, D.I. | Deposition date: | 2025-01-24 |
|
PDBID: | 9lp5 | Status: | HPUB -- hold until publication | Title: | The crystal structure of human PTP1B | Authors: | Zhang, J., Lin, L., Yuchi, Z., Luo, D. | Deposition date: | 2025-01-24 |
|
PDBID: | 9lpe | Status: | HPUB -- hold until publication | Title: | ATPDF2 HDZIP domain complexed with DNA | Authors: | Chen, W., Huang, H.D. | Deposition date: | 2025-01-24 |
|
PDBID: | 9n05 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of GLP-1R-Gs complex with SRB103Q | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M., Piper, S. | Deposition date: | 2025-01-23 |
|
PDBID: | 9mzw | Status: | HPUB -- hold until publication | Title: | PP2A-B55 holoenzyme | Authors: | Shi, S., Li, X., Alderman, C., Huang, W., Taylor, D., Zhao, R. | Deposition date: | 2025-01-23 |
|
PDBID: | 9n04 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of GCGR-Gs complex with peptide 15 | Authors: | Zhang, X., Jiang, Y., Belousoff, M.J., Wootten, D., Sexton, P.M. | Deposition date: | 2025-01-23 |
|
PDBID: | 9i3l | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of E.coli ribosome with filamin mutant Y719E nascent chain at linker length of 47 amino acids, with tRNA | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | Deposition date: | 2025-01-23 |
|
PDBID: | 9lol | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human MON1A-CCZ1-RAB7A | Authors: | Li, X., Li, D., Tang, D., Wang, J., Qi, S. | Deposition date: | 2025-01-23 |
|
PDBID: | 9lok | Status: | HPUB -- hold until publication | Title: | The co-crystal structure of PTP1B complex with allosteric inhibitor Fumosorinone | Authors: | Zhang, J., Lin, L., Yuchi, Z., Luo, D. | Deposition date: | 2025-01-23 |
|
PDBID: | 9mzf | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of GLP-1R-Gs complex with peptide 15 | Authors: | Zhang, X., Belousoff, J.M., Wootten, D., Sexton, M.P. | Deposition date: | 2025-01-22 |
|
PDBID: | 9mze | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of GLP-1R-Gs complex with oxyntomodulin | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M. | Deposition date: | 2025-01-22 |
|
PDBID: | 9mzg | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of GCGR-Gs complex with glucagon | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M., Jiang, Y. | Deposition date: | 2025-01-22 |
|
PDBID: | 9i3f | Status: | HPUB -- hold until publication | Title: | Crystal structure of the AGR2 and IRE1beta_loop complex | Authors: | Yan, Y., Ron, D. | Deposition date: | 2025-01-22 |
|
PDBID: | 9lnf | Status: | HPUB -- hold until publication | Title: | Crystal structure of SpoIVB_101-426-S378A | Authors: | Jiang, L.G., Zhu, J., Huang, M.D. | Deposition date: | 2025-01-21 |
|