| PDBID: | 9qev | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9qez | | Status: | HPUB -- hold until publication | | Title: | Carbonic anhydrase mutant | | Authors: | Mohsin, I., Papageorgiou, A.C. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m82 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m8h | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-03-11 | | Release date: | 2026-03-11 |
|
| PDBID: | 9m80 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m89 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-03-11 | | Release date: | 2026-03-11 |
|
| PDBID: | 9m7q | | Status: | HPUB -- hold until publication | | Title: | Structure of flagellar hook at 3.18 angstroms resolution,conformation 1. | | Authors: | Chen, L.X., Jiang, W.X., Cheng, X.Q., Dong, X., Xing, Q. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m7p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m87 | | Status: | HPUB -- hold until publication | | Title: | Mo1033, Conopressin from Conus monile | | Authors: | Dhurjad, P., Sonti, R. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m83 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m7z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m8b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-03-11 | | Release date: | 2026-03-11 |
|
| PDBID: | 9m8d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-03-11 | | Release date: | 2026-03-11 |
|
| PDBID: | 9m7r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m7s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | At S1+2S3 trimer | | Authors: | Zhang, S.S. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m7u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | At S1+tRNA trimer | | Authors: | Zhang, S.S. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m7x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of bacteriophage NF5 C1 RBP | | Authors: | Peng, Y.N., Liu, H.R. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m7w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | At 2S1+S3-tRNA trimer | | Authors: | Zhang, S.S. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m81 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m8e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-03-11 | | Release date: | 2026-03-11 |
|
| PDBID: | 9m8f | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-03-11 | | Release date: | 2026-03-11 |
|
| PDBID: | 9m8g | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-03-11 | | Release date: | 2026-03-11 |
|
| PDBID: | 9m86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m8a | | Status: | HPUB -- hold until publication | | Title: | METHYLENE BLUE SENSITIVITY 1 | | Authors: | Xu, N., Shao, N., Li, J. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m85 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-03-11 | | Release date: | 2026-03-11 | | Sequence: | >Entity 1
MHHHHHHMTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGKPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL
|
|
