PDBID: | 8qhf | Status: | HPUB -- hold until publication | Title: | Corynebacterium glutamicum mycoloyltransferase C acyl-enzyme intermediate | Authors: | Li de la Sierra-Gallay, I., Lesur, E. | Deposition date: | 2023-09-08 |
|
PDBID: | 8u40 | Status: | HPUB -- hold until publication | Title: | Crystal structure of main protease of SARS-CoV-2 complexed with inhibitor | Authors: | Chen, P., Arutyunova, E., Lu, J., Young, H.S., Lemieux, M.J. | Deposition date: | 2023-09-08 |
|
PDBID: | 8u25 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F/E166A/L167F Triple Mutant | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | Deposition date: | 2023-09-05 |
|
PDBID: | 8u1y | Status: | HPUB -- hold until publication | Title: | E.coli DsbA in complex with N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-04 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8u1h | Status: | HPUB -- hold until publication | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | Deposition date: | 2023-09-01 |
|
PDBID: | 8qdj | Status: | HPUB -- hold until publication | Title: | Ntaya virus methyltransferase in complex wih Sinefungin | Authors: | Krejcova, K., Boura, E., Klima, M. | Deposition date: | 2023-08-29 |
|
PDBID: | 8w67 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Glycogen branching enzyme (VvGBE) from Vibrio vulnificus MO6-24/O | Authors: | An, Y., Park, J.T., Woo, E.J. | Deposition date: | 2023-08-28 |
|
PDBID: | 8qco | Status: | HPUB -- hold until publication | Title: | E.coli IspE in complex with a ligand (3) | Authors: | Hamid, R. | Deposition date: | 2023-08-28 |
|
PDBID: | 8qcn | Status: | HPUB -- hold until publication | Title: | E.coli IspE in complex with a ligand (2) | Authors: | Hamid, R. | Deposition date: | 2023-08-27 |
|
PDBID: | 8qcc | Status: | HPUB -- hold until publication | Title: | E.coli IspE in complex with a ligand (1) | Authors: | Hamid, R. | Deposition date: | 2023-08-25 |
|
PDBID: | 8qce | Status: | HPUB -- hold until publication | Title: | Dispersin from Lactiplantibacillus paraplantarum DispLp | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | Deposition date: | 2023-08-25 | Release date: | 2025-02-25 |
|
PDBID: | 8tyk | Status: | HPUB -- hold until publication | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) T21I Mutant | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | Deposition date: | 2023-08-25 |
|
PDBID: | 8qb6 | Status: | HPUB -- hold until publication | Title: | Dispersin from Terribacillus saccharophilus DispTs2 | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | Deposition date: | 2023-08-24 | Release date: | 2025-02-28 |
|
PDBID: | 8qak | Status: | HPUB -- hold until publication | Title: | Dispersin from Terribacillus saccharophilus DispTs3 | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | Deposition date: | 2023-08-22 | Release date: | 2025-02-28 |
|
PDBID: | 8q8i | Status: | HPUB -- hold until publication | Title: | AO75L in complex with a synthetic trisaccharide acceptor. | Authors: | Laugueri, M.E., Speciale, I., Gimeno, A., Sicheng, L., Poveda, A., Lowary, T., Van Etten J, L., Barbero, J., De Castro, C., Tonetti, M., Rojas A, L. | Deposition date: | 2023-08-18 |
|
PDBID: | 8q7o | Status: | HPUB -- hold until publication | Title: | Crystal structure of the FZD3 cysteine-rich domain in complex with a nanobody (14478) | Authors: | Hillier, J.S., Zhao, Y., Malinauskas, T., Jones, E.Y. | Deposition date: | 2023-08-16 |
|
PDBID: | 8ttt | Status: | HOLD -- hold until a certain date | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 15 (1124-1140) | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | Deposition date: | 2023-08-15 | Release date: | 2024-08-15 |
|
PDBID: | 8ttu | Status: | HOLD -- hold until a certain date | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 19 (1261 - 1274) | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | Deposition date: | 2023-08-15 | Release date: | 2024-08-15 |
|
PDBID: | 8ttv | Status: | HOLD -- hold until a certain date | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 20 (1289-1302) | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | Deposition date: | 2023-08-15 | Release date: | 2024-08-15 |
|
PDBID: | 8tt8 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 |
|
PDBID: | 8tt9 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 | Sequence: | >Entity 1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
PDBID: | 8tta | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 21 (1328-1341) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttc | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 20 (1289-1302) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttd | Status: | HOLD -- hold until a certain date | Title: | Structure of VPS29 complexed with Fam21A repeat 21 (1328-1341) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 7gau | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition of ground-state model of MAP1LC3B | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-11 |
|