| PDBID: | 9vf9 | | Status: | HPUB -- hold until publication | | Title: | GSTM1 in complex with bithionol | | Authors: | Sun, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1u | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ube2E3 | | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
| PDBID: | 9p1k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of sensory domain of CdgA from Vibrio cholerae O1 biovar El Tor str. N16961 | | Authors: | Marceau, A.H., Mariscal, V.T., Tripathi, S.M., Yildiz, F.H., Rubin, S.M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 100K human S-adenosylmethionine decarboxylase | | Authors: | Patel, J.R., Bonzon, T.J., Bahkt, T., Faghobun, O.O., Clinger, J.A. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural of MAb PhtD3 in complex with PhtD | | Authors: | Du, J., Cui, J., Lin, Z., Eisenhauer, J., Pallesen, J., Weiner, D.B. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the apo form of CLZ9 from Streptomyces | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of TCZ9 from Streptomyces | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Staphylococcus aureus ClpP in complex with chimerabactin | | Authors: | Lee, R.E., Griffith, E.C. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of TCZ9 bound with Cannabigerolic acid (CBGA) | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Atomic structure of vibrio effector fragment VopV bound to Beta-cytoplasmic/gamma1-cytoplasmic F-actin | | Authors: | Kreutzberger, M.A., Kudryashova, E., Egelman, E.H., Kudryashov, D.S. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | A2AR-BRIL in complex with ZM241385 | | Authors: | Rao, P., Rathinaswamy, M., Chan, M., Paredes, A.G., Patel, C., Wranik, B.J., Powell, J., Eaton, D., Hicks, K.J., Mafi, A., Hao, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FusA (ferredoxin receptor from Pectobacterium atrosepticum) in the presence of Ra-LPS | | Authors: | Machin, J.M., Ranson, N.A. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of 3CL protease with a bound inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9ri1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS-CoV-2 with a bound inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9rhl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9rhm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9rho | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of SARS-coV-2 NSP3 macrodomain in complex with ligand | | Authors: | Ruiz Carrillo, D., Sander, S., Tidow, H., Garcia-Alai, M. | | Deposition date: | 2025-06-09 |
|
