PDBID: | 9vf9 | Status: | HPUB -- hold until publication | Title: | GSTM1 in complex with bithionol | Authors: | Sun, Q. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1u | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1q | Status: | HPUB -- hold until publication | Title: | Crystal structure of Ube2E3 | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | Deposition date: | 2025-06-10 | Sequence: | >Entity 1 MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
PDBID: | 9p1k | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of sensory domain of CdgA from Vibrio cholerae O1 biovar El Tor str. N16961 | Authors: | Marceau, A.H., Mariscal, V.T., Tripathi, S.M., Yildiz, F.H., Rubin, S.M. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1l | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1h | Status: | AUTH -- processed, waiting for author review and approval | Title: | 100K human S-adenosylmethionine decarboxylase | Authors: | Patel, J.R., Bonzon, T.J., Bahkt, T., Faghobun, O.O., Clinger, J.A. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1v | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structural of MAb PhtD3 in complex with PhtD | Authors: | Du, J., Cui, J., Lin, Z., Eisenhauer, J., Pallesen, J., Weiner, D.B. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1p | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the apo form of CLZ9 from Streptomyces | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1r | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of TCZ9 from Streptomyces | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1j | Status: | AUTH -- processed, waiting for author review and approval | Title: | Staphylococcus aureus ClpP in complex with chimerabactin | Authors: | Lee, R.E., Griffith, E.C. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1n | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1o | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of TCZ9 bound with Cannabigerolic acid (CBGA) | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Atomic structure of vibrio effector fragment VopV bound to Beta-cytoplasmic/gamma1-cytoplasmic F-actin | Authors: | Kreutzberger, M.A., Kudryashova, E., Egelman, E.H., Kudryashov, D.S. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1s | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1m | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1t | Status: | AUTH -- processed, waiting for author review and approval | Title: | A2AR-BRIL in complex with ZM241385 | Authors: | Rao, P., Rathinaswamy, M., Chan, M., Paredes, A.G., Patel, C., Wranik, B.J., Powell, J., Eaton, D., Hicks, K.J., Mafi, A., Hao, Q. | Deposition date: | 2025-06-10 |
|
PDBID: | 9rhr | Status: | AUTH -- processed, waiting for author review and approval | Title: | FusA (ferredoxin receptor from Pectobacterium atrosepticum) in the presence of Ra-LPS | Authors: | Machin, J.M., Ranson, N.A. | Deposition date: | 2025-06-10 |
|
PDBID: | 9rhw | Status: | HPUB -- hold until publication | Deposition date: | 2025-06-10 |
|
PDBID: | 9rhs | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of 3CL protease with a bound inhibitor | Authors: | Mac Sweeney, A. | Deposition date: | 2025-06-10 |
|
PDBID: | 9rhy | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-10 |
|
PDBID: | 9ri1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | SARS-CoV-2 with a bound inhibitor | Authors: | Mac Sweeney, A. | Deposition date: | 2025-06-10 |
|
PDBID: | 9rhj | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-09 |
|
PDBID: | 9rhl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-09 |
|
PDBID: | 9rhm | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-09 |
|
PDBID: | 9rho | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of SARS-coV-2 NSP3 macrodomain in complex with ligand | Authors: | Ruiz Carrillo, D., Sander, S., Tidow, H., Garcia-Alai, M. | Deposition date: | 2025-06-09 |
|