| PDBID: | 9imw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of N-terminal domain of human Hsp90 | | Authors: | Huang, L.Q., Yu, F. | | Deposition date: | 2024-07-04 |
|
| PDBID: | 9imx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Immune complex of HEV E2s and P1-5B nanobody | | Authors: | Tingting, L., Wenhui, X., Ying, G., Shaowei, L. | | Deposition date: | 2024-07-04 |
|
| PDBID: | 9cis | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the pyrophosphate-dependent phosphofructokinase from Candidatus Prometheoarchaeum syntrophicum with fructose 6-phosphate | | Authors: | Compton, J.A., Yosaatmadja, Y., Bashiri, G., Vickers, C.J., Patrick, W.M. | | Deposition date: | 2024-07-04 | | Release date: | 2025-07-04 |
|
| PDBID: | 9cir | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of pyrophosphate-dependent phosphofructokinase from Candidatus Prometheoarchaeum syntrophicum | | Authors: | Compton, J.A., Yosaatmadja, Y., Bashiri, G., Vickers, C.J., Patrick, W.M. | | Deposition date: | 2024-07-04 | | Release date: | 2025-07-04 |
|
| PDBID: | 9cit | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of pyrophosphate-dependent phosphofructokinase from Candidatus Prometheoarchaeum syntrophicum with phosphoenolpyruvate, phosphate and Mg2+ | | Authors: | Compton, J.A., Yosaatmadja, Y., Bashiri, G., Vickers, C.J., Patrick, W.M. | | Deposition date: | 2024-07-04 | | Release date: | 2025-07-04 |
|
| PDBID: | 9imq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-04 |
|
| PDBID: | 9fyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fy8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of native SV2A in complex with TeNT-Hc, gangliosides and Pro-Macrobody 5 | | Authors: | Schenck, S., Brunner, J.D. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of native SV2A in complex with TeNT-Hc, Pro-Macrobody 5 and Levetiracetam | | Authors: | Schenck, S., Brunner, J.D. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyj | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand | | Authors: | Adrover Forteza, J., Puric, E., Nilsson, U.J., Anderluh, M., Logan, D.T. | | Deposition date: | 2024-07-03 | | Sequence: | >Entity 1
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSD
|
|
| PDBID: | 9fyh | | Status: | HOLD -- hold until a certain date | | Title: | Dye Type Peroxidase Aa from Streptomyces lividans by microcrystal electron diffraction (MicroED/3D ED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Finjallaz, A., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2024-07-03 | | Release date: | 2025-07-03 |
|
| PDBID: | 9fyk | | Status: | HPUB -- hold until publication | | Title: | Dye Type Peroxidase Aa from Streptomyces lividans by serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Finjallaz, A., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fya | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fye | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fyt | | Status: | HPUB -- hold until publication | | Title: | mAbs in complex with cobratoxin at pH 4.5 | | Authors: | Wade, J., Bohn, M.F., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fys | | Status: | HPUB -- hold until publication | | Title: | D11 mAbs bound to alpha-Bungarotoxin | | Authors: | Wade, J., Bohn, M.F., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9fy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9ime | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of di-NMPylated HEPN family toxin | | Authors: | Wang, X.X., Chen, R., Yao, J.Y. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 9imi | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of UGT94BY1 in complex with UDP | | Authors: | Jiang, Z., Yuan, Y. | | Deposition date: | 2024-07-03 | | Release date: | 2025-07-03 |
|
| PDBID: | 9imn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a TEF30-associated intermediate PSII core dimer complex, type I, from Chlamydomonas reinhardtii | | Authors: | Wang, Y., Wang, C., Li, A., Liu, Z. | | Deposition date: | 2024-07-03 |
|
