Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9sby
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Yeast RNA polymerase II elongation complex with ATP frame-14
Authors:Yi, G., Li, Q., Zhang, P., Wang, D.
Deposition date:2025-08-08
PDBID:9sc0
Status:HPUB -- hold until publication
Title:Structure of Yeast RNA polymerase II elongation complex with ATP frame-16
Authors:Yi, G., Li, Q., Zhang, P., Wang, D.
Deposition date:2025-08-08
PDBID:9sc1
Status:HPUB -- hold until publication
Title:Structure of Yeast RNA polymerase II elongation complex with ATP frame-17
Authors:Yi, G., Li, Q., Zhang, P., Wang, D.
Deposition date:2025-08-08
PDBID:9sc2
Status:HPUB -- hold until publication
Title:Structure of Yeast RNA polymerase II elongation complex with ATP frame-18
Authors:Yi, G., Li, Q., Zhang, P., Wang, D.
Deposition date:2025-08-08
PDBID:9sc3
Status:HPUB -- hold until publication
Title:Structure of Yeast RNA polymerase II elongation complex with ATP frame-19
Authors:Yi, G., Li, Q., Zhang, P., Wang, D.
Deposition date:2025-08-08
PDBID:9sc4
Status:HPUB -- hold until publication
Title:Structure of Yeast RNA polymerase II elongation complex with ATP frame-20
Authors:Yi, G., Li, Q., Zhang, P., Wang, D.
Deposition date:2025-08-08
PDBID:9sbz
Status:HPUB -- hold until publication
Title:Structure of Yeast RNA polymerase II elongation complex with ATP frame-15
Authors:Yi, G., Li, Q., Zhang, P., Wang, D.
Deposition date:2025-08-08
PDBID:9say
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Structure of Yeast RNA polymerase II elongation complex apo-state-I
Authors:Yi, G., Li, Q., Zhang, P., Wang, D.
Deposition date:2025-08-08
PDBID:9sb1
Status:HPUB -- hold until publication
Title:Structure of Yeast RNA polymerase II elongation complex with NTP-state-VII-A
Authors:Yi, G., Li, Q., Zhang, P., Wang, D.
Deposition date:2025-08-08
PDBID:9pz4
Status:HPUB -- hold until publication
Title:Crystal structure of 2-methoxyhydroquinone dioxygenase (MhdA) from Gelatoporia subvermispora
Authors:Mathews, I.I., Kuatsjah, E., Schwartz, A., Sarangi, R., McGeehan, J.E., Salvachua, D.
Deposition date:2025-08-08
PDBID:9pyo
Status:HPUB -- hold until publication
Title:Crystal structure of Fe/2-OG dependent dioxygenase MysH in complex with iron and 2-oxoglutarate
Authors:Wanniarachchi, T.N., Bruner, S.D.
Deposition date:2025-08-08
PDBID:9w93
Status:HPUB -- hold until publication
Title:Crystal Structure of a novel amidase variant with complex from Sphingomonas sp
Authors:Li, W.S., Chen, Y.Y., Zhang, S.Y., Li, Z.S., Han, X., Liu, W.D.
Deposition date:2025-08-08
PDBID:9saj
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 NSP14 in complex with compound 5
Authors:Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsforth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I.
Deposition date:2025-08-07
PDBID:9sak
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 NSP14 in complex with compound 6
Authors:Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsforth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I.
Deposition date:2025-08-07
PDBID:9sal
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 NSP14 in complex with compound 18
Authors:Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsforth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I.
Deposition date:2025-08-07
PDBID:9sam
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 NSP14 in complex with compound 26
Authors:Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsforth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I.
Deposition date:2025-08-07
PDBID:9sas
Status:AUTH -- processed, waiting for author review and approval
Title:Chlorophyll synthase in complex with the LHC-like protein HliD, apo state
Authors:Shvarev, D., Hitchcock, A., Sobotka, R.
Deposition date:2025-08-07
PDBID:9san
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 NSP14 in complex with compound 27
Authors:Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsforth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I.
Deposition date:2025-08-07
PDBID:9sau
Status:PROC -- to be processed
Title:Chlorophyll synthase in complex with the LHC-like protein HliD, GGPP-bound state
Authors:Shvarev, D., Hitchcock, A., Sobotka, R.
Deposition date:2025-08-07
PDBID:9w7v
Status:HPUB -- hold until publication
Title:SuperFi Cas9 - 20nt sgRNA - DNA ternary complex Class D
Authors:Zheng, R., Ma, L.J.
Deposition date:2025-08-07
PDBID:9s9g
Status:HPUB -- hold until publication
Title:S. islandicus CdvA filament (X-ray)
Authors:Salzer, R., Lowe, J., Bellini, D.
Deposition date:2025-08-06
Sequence:

>Entity 1


MPVSYEVLTKFIGQKVKDIYGREFGYLIHVYSEIDGSITGIEVAQGSSILTMGPERIKLDGDSILILPDWKAEAIRILSLMEKIRKRQRALEELYNKQEIPKSDYDDMKRKLDTEMLKVKDDQNKLKGKLKSRLNDIEDQLAHIDKAVISLKMSYISSEIPENAYKGSMEVLRQSKDSYTLERDDIRKTLDRLDSLDKESIELKPLGSLSTSQQGEAKSDQSKSEIPLPIPVKVINTL
PDBID:9s9i
Status:HPUB -- hold until publication
Title:S. islandicus CdvA (non-polymerising mutant)
Authors:Salzer, R., Lowe, J., Bellini, D.
Deposition date:2025-08-06
Sequence:

>Entity 1


MPVSYEVLTKFIGQKVKDIYGREFGYLIHVYSEIDGSITGIEVAQGSSILTMGPERIKLDGDSILILPDWKAEAIRILSLMEKIRKRQRDLEEDYNKQEDPKSDYDDMKRKLDTEMLKVKDDQNKLKGKLKSRLNDIEDQLAHIDKAVDSLKDSYDSSEIPENAYKGSMEVLRQSKDSYTLERDDIRKTLDRLDSLDKESIELKPLGSLSTSQQGEAKSDQSKSEIPLPIPVKVINTL
PDBID:7ik9
Status:HPUB -- hold until publication
Title:Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1198177230
Authors:Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J.
Deposition date:2025-08-06
PDBID:7ika
Status:HPUB -- hold until publication
Title:Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1203730757
Authors:Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J.
Deposition date:2025-08-06
PDBID:7ikb
Status:HPUB -- hold until publication
Title:Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1255459547
Authors:Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J.
Deposition date:2025-08-06

245663

数据于2025-12-03公开中

PDB statisticsPDBj update infoContact PDBjnumon