Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9uj8
Status:HPUB -- hold until publication
Title:Crystal structure of SME-1 E166A with cefovecin
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9uja
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of SME-1 E166A with cefotetan
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9uk2
Status:AUTH -- processed, waiting for author review and approval
Title:Human OXGR1-miniGq complex (conformation 1)
Authors:Wang, C., Liu, H.
Deposition date:2025-04-17
PDBID:9uj5
Status:HPUB -- hold until publication
Title:Crystal structure of SME-1 E166A in complex with cefprozil
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9uj6
Status:HPUB -- hold until publication
Title:Crystal structure of SME-1 E166A in complex with cefsulodin
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9ujb
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of SME-1 E166A in complex with Ceftobiprole
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9ujc
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of SME-1 E166A with cefpirome
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9qxz
Status:HPUB -- hold until publication
Title:Structure of human NONO bound to (R)-SKBG-1 in p212121
Authors:Fribourg, S., Fribourg, S.
Deposition date:2025-04-16
PDBID:9qy4
Status:HPUB -- hold until publication
Title:GT108 family enzyme from Chlamydia abortus in complex with mannose-1-phosphate (M1P)
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-16
PDBID:9uir
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the prostaglandin D2 receptor 1 (DP1) bound to the antagonist laropiprant resolved via the fusion/crosslinking strategy
Authors:Han, S.C., Li, M.H.
Deposition date:2025-04-16
PDBID:9uis
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the prostaglandin D2 receptor 1 (DP1) bound to the antagonist asapiprant resolved via the fusion/crosslinking strategy
Authors:Han, S.C., Li, M.H.
Deposition date:2025-04-16
PDBID:9o84
Status:HPUB -- hold until publication
Title:Structure of turkey hemoglobin A at 1.7 Angstrom resolution (tetragonal form)
Authors:Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P.
Deposition date:2025-04-15
PDBID:9qwl
Status:HPUB -- hold until publication
Title:Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343
Authors:Sauer, U.H., Cisneros, D.A.
Deposition date:2025-04-14
Sequence:

>Entity 1


(MSE)AFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILEN(MSE)TNQFKPHSGSIVFKKGDEEAK(MSE)KELTWENGYITEFTENIDIVGSQP(MSE)TITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH
PDBID:9uhf
Status:HPUB -- hold until publication
Title:JN.1 RBD in complex with antibody BA5-12
Authors:Yue, C., Mao, X.
Deposition date:2025-04-14
PDBID:9uhg
Status:AUTH -- processed, waiting for author review and approval
Title:JN.1 RBD in complex with antibody BA5-12-CDR1
Authors:Yue, C., Mao, X.
Deposition date:2025-04-14
PDBID:9uh9
Status:HPUB -- hold until publication
Title:human Ribonuclease MRP state 1
Authors:Zhou, B., Lan, P., Wu, J., Lei, M.
Deposition date:2025-04-14
PDBID:9uho
Status:AUTH -- processed, waiting for author review and approval
Title:JN.1 Spike in complex with antibody BA5-39
Authors:Yue, C., Mao, X.
Deposition date:2025-04-14
PDBID:9uhq
Status:HPUB -- hold until publication
Title:Local refinement of JN.1 spike in complex with antibody BA5-39
Authors:Yue, C., Mao, X.
Deposition date:2025-04-14
PDBID:9qvy
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme complex with mannose-1-phosphate (M1P)
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-13
PDBID:9qvu
Status:HPUB -- hold until publication
Title:Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand
Authors:Shrive, A.K., Greenhough, T.J., Williams, H.M.
Deposition date:2025-04-12
Sequence:

>Entity 1


GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
PDBID:9qv4
Status:HPUB -- hold until publication
Title:1-Phosphofructokinase mutant K95T/G110S from E. coli with bound fructose-1,6-bisphosphate and ADP
Authors:Zarzycki, J., Dronsella, B., Erb, T.J., Lindner, S.N.
Deposition date:2025-04-11
PDBID:9uf6
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of BA1-1-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9uey
Status:HPUB -- hold until publication
Title:CTP synthase PRE-state 1
Authors:Guo, C.J.
Deposition date:2025-04-09
PDBID:9o4t
Status:HPUB -- hold until publication
Title:RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell
Authors:Wolff, A.M., Thompson, M.C.
Deposition date:2025-04-08
PDBID:9o2w
Status:HPUB -- hold until publication
Title:Crystal structure of NDM-1 complexed with compound 3
Authors:Jacobs, L.M.C., Chen, Y.
Deposition date:2025-04-04

243911

数据于2025-10-29公开中

PDB statisticsPDBj update infoContact PDBjnumon