| PDBID: | 9qkq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hTEAD4 YAP binding domain (hTEAD4-YBD) in complex with peptide 6 | | Authors: | Pozzi, C. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GSHMRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
>Entity 2
(ACE)P(6CW)RLRK(NLE)PDSF(ALN)KPP(NH2)
|
|
| PDBID: | 9qld | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-nitrophenol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9qkp | | Status: | HPUB -- hold until publication | | Title: | Structure of the cyanobacteria specific PRK from Chroococcidiopsis (Hyella disjuncta) PCC 6712 (P41212 crystal form) | | Authors: | Tufail, F., Yang, L., Murray, J.W. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qlb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human CRP-CPS23F complex | | Authors: | Chen, D.Y., Xie, Y.F., Gao, F., Qi, J.X., Zhang, J.R. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4c | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u48 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u47 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4g | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u40 | | Status: | PROC -- to be processed | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u49 | | Status: | HPUB -- hold until publication | | Title: | crystal structure of Cdn1 in complex with cA4 | | Authors: | Zhang, W. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4k | | Status: | HPUB -- hold until publication | | Title: | Serine Beta-Lactamase OXA-48 in complex with Dual MBL/SBL inhibitor FB3-4 | | Authors: | Li, G.-B., Liang, G.-Q. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4i | | Status: | HPUB -- hold until publication | | Title: | Serine Beta-Lactamase OXA-48 in complex with Dual MBL/SBL inhibitor FB1-1 | | Authors: | Li, G.-B., Liang, G.-Q. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4j | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR4-apo Receptor in pH 7.8 | | Authors: | Zhong, Y.N., Liu, Z.L., Guo, L.L., Sun, J.P., Yang, F. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u4p | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 tail domain Q387-L400 in solution | | Authors: | Ji, Y., Jeong, M., Kim, J., Lee, C.H. | | Deposition date: | 2025-03-19 | | Release date: | 2026-03-19 | | Sequence: | >Entity 1
QEDHYNNLSASKVL
|
|
