| PDBID: | 9nvs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of rhesus antibody CH35-Apex1.08 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qm7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S-nitrosylated triose phosphate isomerase from Chlamydomonas reinhardtii | | Authors: | Fanti, S., Fermani, S., Gabellini, G., Zaffagnini, M., Meloni, M., Peppi, G.M.E. | | Deposition date: | 2025-03-21 | | Sequence: | >Entity 1
ASSAKFFVGGNWK(SNC)NGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
|
|
| PDBID: | 9qlh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qli | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qm6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of highly stable methionine gamma-lyase from Thermobrachium celere in complex with PLP and norleucine | | Authors: | Kopecny, D., Ferchaud, N., Briozzo, P. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlk | | Status: | HOLD -- hold until a certain date | | Title: | Structure of piperazate synthase from Streptomyces sp. | | Authors: | Pal, N., Schroder, S., Daniel, B., Gruber, K. | | Deposition date: | 2025-03-21 | | Release date: | 2025-05-16 |
|
| PDBID: | 9qm3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qll | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of holo-D4A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qly | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of holo-D130A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlt | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Dimeric Apo-D154A-FNR of A. Fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qm4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a [2Fe-2S] form of D4A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlj | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a Disordered Apo-form of A. Fischeri FNR | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qm5 | | Status: | HPUB -- hold until publication | | Title: | Krypton-pressurized Methyl-Coenzyme M reductase of an ANME-2c isolated from a microbial enrichment | | Authors: | Mueller, M.-C., Wagner, T. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis TIR-NLR WRR4A tetramer in complex with effector CCG40 | | Authors: | Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J. | | Deposition date: | 2025-03-21 |
|
