PDBID: | 8qsh | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 23 (1083848). | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qse | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 23 (1083848). | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qsf | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 22 (1083853). | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qsd | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 79 (1124379). | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qsc | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 22 (1083853). | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qsb | Status: | AUTH -- processed, waiting for author review and approval | Title: | Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 86 (1124384). | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qsg | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 86 (1124384). | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs2 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 29 (1076409) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs3 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 23 (1083848) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs4 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 22 (1083853) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs6 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qri | Status: | HPUB -- hold until publication | Title: | TRRAP and EP400 in the human Tip60 complex | Authors: | Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., SChultz, P., Papai, G., Ben-Shem, A. | Deposition date: | 2023-10-09 |
|
PDBID: | 8qr1 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the human Tip60 complex | Authors: | Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., Schultz, P., Papai, G., Ben-Shem, A. | Deposition date: | 2023-10-06 |
|
PDBID: | 8ugt | Status: | HPUB -- hold until publication | Title: | E. eligens beta-glucuronidase bound to UNC10206581-G | Authors: | Simpson, J.B., Redinbo, M.R. | Deposition date: | 2023-10-06 |
|
PDBID: | 8ugw | Status: | HPUB -- hold until publication | Title: | Computational design of highly signaling active membrane receptors through de novo solvent-mediated allosteric networks | Authors: | Wang, J., Chen, K.Y., Lai, J.K., Russell, A.M., Conners, K., Rutter, M.E., Condon, B., Tung, F., Kodandapani, L., Chau, B., Zhao, X., Benach, J., Baker, K., Hembre, E.J., Barth, P. | Deposition date: | 2023-10-06 |
|
PDBID: | 8qpt | Status: | HPUB -- hold until publication | Title: | Crystal structure of pyrophosphatase from Ogataea parapolymorpha | Authors: | Matyuta, I.O., Rodina, E.V., Vorobyeva, N.N., Kurilova, S.A., Bezpalaya, E.Y., Boyko, K.M. | Deposition date: | 2023-10-03 | Sequence: | >Entity 1 MLKLSRALSSVVSGTRNSPSFKTYLRLKDGKIGSFFHDVPLGLDKQKRIANMVVEIPRWVNAKYEISKDFKANPIVQDTKKGKLRYLNNIYPNHGVPHNYGAFPQTWESPLESSSLVNQNILGDNDPLDVIDIGRFVSSTGTVKPVKILGSLALVDDGELDWKVVVIDTNDPFAAELNDIKDVYEKMPGVLENLKRWFEVYKIPTGKEPNSFLFDGNYKDTEFTLKVVQECHENWYKLVMGELHGDNLPSTENATLPHTKGNTVFDVEIEVSQKAEQVPPEVNDMSFIK
|
|
PDBID: | 8uf3 | Status: | HPUB -- hold until publication | Title: | Structure of cytochrome c4 from Neisseria gonorrhoeae | Authors: | Zhong, F., Ragusa, M.J., Pletneva, E.V. | Deposition date: | 2023-10-03 |
|
PDBID: | 8uen | Status: | HPUB -- hold until publication | Title: | Crystal structure of Corynebacterium ulcerans endo-beta-N-acetylglucosaminidase catalytically inactive CU43 D187A-E189A at 2.3 A (P 21 21 2) | Authors: | Sastre, D.E., Sultana, N., Sundberg, E.J. | Deposition date: | 2023-10-02 |
|
PDBID: | 8wkz | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Melanocortin-4 Receptor (MC4R) in complex with S31 | Authors: | Gimenez, L.E., Martin, C., Yu, J., Hollanders, C., Hernandez, C., Dahir, N.S., Wu, Y., Yao, D., Han, G.W., Wu, L., Poorten, O.V., Lamouroux, A., Mannes, M., Tourwe, D., Zhao, S., Stevens, R.C., Cone, R.D., Ballet, S. | Deposition date: | 2023-09-28 |
|
PDBID: | 8wj5 | Status: | HPUB -- hold until publication | Title: | Double-wing domain of E. coli YdcD | Authors: | Kamata, K., Tame, J.R.H. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wia | Status: | HPUB -- hold until publication | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463S | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | Deposition date: | 2023-09-24 |
|
PDBID: | 8wig | Status: | HPUB -- hold until publication | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463S/Q484A | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | Deposition date: | 2023-09-24 |
|
PDBID: | 8wih | Status: | HPUB -- hold until publication | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with ATP | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | Deposition date: | 2023-09-24 |
|
PDBID: | 8wii | Status: | HPUB -- hold until publication | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with Obafluorin | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | Deposition date: | 2023-09-24 |
|
PDBID: | 8wij | Status: | HPUB -- hold until publication | Title: | Crystal structure of E. coli ThrS catalytic domain mutant L489M in complex with Obafluorin | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | Deposition date: | 2023-09-24 |
|