Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8qsh
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 23 (1083848).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qse
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 23 (1083848).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsf
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 22 (1083853).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsd
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 79 (1124379).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsc
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 22 (1083853).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsb
Status:AUTH -- processed, waiting for author review and approval
Title:Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 86 (1124384).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qsg
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 86 (1124384).
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs2
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 29 (1076409)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs3
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 23 (1083848)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs4
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 22 (1083853)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qs6
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
PDBID:8qri
Status:HPUB -- hold until publication
Title:TRRAP and EP400 in the human Tip60 complex
Authors:Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., SChultz, P., Papai, G., Ben-Shem, A.
Deposition date:2023-10-09
PDBID:8qr1
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the human Tip60 complex
Authors:Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., Schultz, P., Papai, G., Ben-Shem, A.
Deposition date:2023-10-06
PDBID:8ugt
Status:HPUB -- hold until publication
Title:E. eligens beta-glucuronidase bound to UNC10206581-G
Authors:Simpson, J.B., Redinbo, M.R.
Deposition date:2023-10-06
PDBID:8ugw
Status:HPUB -- hold until publication
Title:Computational design of highly signaling active membrane receptors through de novo solvent-mediated allosteric networks
Authors:Wang, J., Chen, K.Y., Lai, J.K., Russell, A.M., Conners, K., Rutter, M.E., Condon, B., Tung, F., Kodandapani, L., Chau, B., Zhao, X., Benach, J., Baker, K., Hembre, E.J., Barth, P.
Deposition date:2023-10-06
PDBID:8qpt
Status:HPUB -- hold until publication
Title:Crystal structure of pyrophosphatase from Ogataea parapolymorpha
Authors:Matyuta, I.O., Rodina, E.V., Vorobyeva, N.N., Kurilova, S.A., Bezpalaya, E.Y., Boyko, K.M.
Deposition date:2023-10-03
Sequence:

>Entity 1


MLKLSRALSSVVSGTRNSPSFKTYLRLKDGKIGSFFHDVPLGLDKQKRIANMVVEIPRWVNAKYEISKDFKANPIVQDTKKGKLRYLNNIYPNHGVPHNYGAFPQTWESPLESSSLVNQNILGDNDPLDVIDIGRFVSSTGTVKPVKILGSLALVDDGELDWKVVVIDTNDPFAAELNDIKDVYEKMPGVLENLKRWFEVYKIPTGKEPNSFLFDGNYKDTEFTLKVVQECHENWYKLVMGELHGDNLPSTENATLPHTKGNTVFDVEIEVSQKAEQVPPEVNDMSFIK
PDBID:8uf3
Status:HPUB -- hold until publication
Title:Structure of cytochrome c4 from Neisseria gonorrhoeae
Authors:Zhong, F., Ragusa, M.J., Pletneva, E.V.
Deposition date:2023-10-03
PDBID:8uen
Status:HPUB -- hold until publication
Title:Crystal structure of Corynebacterium ulcerans endo-beta-N-acetylglucosaminidase catalytically inactive CU43 D187A-E189A at 2.3 A (P 21 21 2)
Authors:Sastre, D.E., Sultana, N., Sundberg, E.J.
Deposition date:2023-10-02
PDBID:8wkz
Status:HPUB -- hold until publication
Title:Crystal structure of the Melanocortin-4 Receptor (MC4R) in complex with S31
Authors:Gimenez, L.E., Martin, C., Yu, J., Hollanders, C., Hernandez, C., Dahir, N.S., Wu, Y., Yao, D., Han, G.W., Wu, L., Poorten, O.V., Lamouroux, A., Mannes, M., Tourwe, D., Zhao, S., Stevens, R.C., Cone, R.D., Ballet, S.
Deposition date:2023-09-28
PDBID:8wj5
Status:HPUB -- hold until publication
Title:Double-wing domain of E. coli YdcD
Authors:Kamata, K., Tame, J.R.H.
Deposition date:2023-09-25
PDBID:8wia
Status:HPUB -- hold until publication
Title:Crystal structure of E. coli ThrS catalytic domain mutant G463S
Authors:Qiao, H., Wang, Z., Wang, J., Fang, P.
Deposition date:2023-09-24
PDBID:8wig
Status:HPUB -- hold until publication
Title:Crystal structure of E. coli ThrS catalytic domain mutant G463S/Q484A
Authors:Qiao, H., Wang, Z., Wang, J., Fang, P.
Deposition date:2023-09-24
PDBID:8wih
Status:HPUB -- hold until publication
Title:Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with ATP
Authors:Qiao, H., Wang, Z., Wang, J., Fang, P.
Deposition date:2023-09-24
PDBID:8wii
Status:HPUB -- hold until publication
Title:Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with Obafluorin
Authors:Qiao, H., Wang, Z., Wang, J., Fang, P.
Deposition date:2023-09-24
PDBID:8wij
Status:HPUB -- hold until publication
Title:Crystal structure of E. coli ThrS catalytic domain mutant L489M in complex with Obafluorin
Authors:Qiao, H., Wang, Z., Wang, J., Fang, P.
Deposition date:2023-09-24

222415

数据于2024-07-10公开中

PDB statisticsPDBj update infoContact PDBjnumon