PDBID: | 9ifz | Status: | HPUB -- hold until publication | Title: | FSP1 (tetrapod ancestor) bound to FAD | Authors: | Cecchini, D., Mattevi, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ncs | Status: | HPUB -- hold until publication | Title: | RNase A in complex with Uridine Vanadate and decavanadates | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | Deposition date: | 2025-02-17 | Sequence: | >Entity 1 KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
PDBID: | 9ncr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and symmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional G/C rich expansion sequence | Authors: | Shields, E.T., Snow, C.D., Slaughter, C.K. | Deposition date: | 2025-02-17 |
|
PDBID: | 9lwt | Status: | AUTH -- processed, waiting for author review and approval | Title: | PL25 ulvan lyase TsUly25A | Authors: | Han, F., Wang, D., Wang, W. | Deposition date: | 2025-02-16 |
|
PDBID: | 9nbm | Status: | HPUB -- hold until publication | Title: | Open conformation of ArsA from L. ferriphilum in complex with MgADP determined in absence of arsenite | Authors: | Mahajan, S., Rees, D.C., Clemons, W.M. | Deposition date: | 2025-02-14 |
|
PDBID: | 9nbo | Status: | HPUB -- hold until publication | Title: | Closed conformation of ArsA from L. ferriphilum in complex with MgATP and arsenite | Authors: | Mahajan, S., Li, Y.E., Rees, D.C., Clemons, W.M. | Deposition date: | 2025-02-14 |
|
PDBID: | 9nbw | Status: | HPUB -- hold until publication | Title: | Closed conformation of ArsA from L. ferriphilum in complex with MgATP and arsenite at 1.5 minute time point | Authors: | Mahajan, S., Rees, D.C., Clemons, W.M. | Deposition date: | 2025-02-14 |
|
PDBID: | 9ic7 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of alpha-synuclein fibrils formed in artificial cerebrospinal fluid (aCSF) | Authors: | Snieckute, R., Sulskis, D., Jocyte, A., Venclovaite, U., Tamulyte, R., Ziaunys, M., Smirnovas, V., Sakalauskas, A. | Deposition date: | 2025-02-14 |
|
PDBID: | 9nbl | Status: | HPUB -- hold until publication | Title: | Open conformation of ArsA from L. ferriphilum in complex with MgADP determined in the presence of arsenite | Authors: | Mahajan, S., Rees, D.C., Clemons, W.M. | Deposition date: | 2025-02-14 |
|
PDBID: | 9nb0 | Status: | HPUB -- hold until publication | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and asymmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional expansion sequence | Authors: | Shields, E.T., Snow, C.D. | Deposition date: | 2025-02-13 |
|
PDBID: | 9nbc | Status: | HPUB -- hold until publication | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-13 |
|
PDBID: | 9nbh | Status: | HPUB -- hold until publication | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer core only | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-13 |
|
PDBID: | 9ibs | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM Structure of Self-assembled Zymomonas mobilis Levansucrase Nanotube | Authors: | Yu, Y., Sonani, R.R., Hadad, N., Salama, R., Shoham, G., Egelman, E., Shoham, Y., Danino, D. | Deposition date: | 2025-02-13 | Release date: | 2026-02-13 |
|
PDBID: | 9nak | Status: | HPUB -- hold until publication | Title: | RNA scaffold attached to tRNA | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-12 |
|
PDBID: | 9nam | Status: | HPUB -- hold until publication | Title: | RNA scaffold attached to Mango in the absence of ligand | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-12 |
|
PDBID: | 9nap | Status: | HPUB -- hold until publication | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-12 |
|
PDBID: | 9nas | Status: | HPUB -- hold until publication | Title: | RNA scaffold attached to disordered U1A stem loop | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-12 |
|
PDBID: | 9ibb | Status: | HPUB -- hold until publication | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | Deposition date: | 2025-02-12 | Sequence: | >Entity 1 GIVEQCCTSICSLYQLENYCN
>Entity 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
PDBID: | 9lvn | Status: | HPUB -- hold until publication | Title: | Crystal structure of phospholipase D SkPLD (Streptomyces klenkii) | Authors: | Hu, R.K., Feng, C.H. | Deposition date: | 2025-02-12 |
|
PDBID: | 9na1 | Status: | HPUB -- hold until publication | Title: | RNA scaffold | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-11 |
|
PDBID: | 9na7 | Status: | HPUB -- hold until publication | Title: | RNA scaffold | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-11 |
|
PDBID: | 9n97 | Status: | HPUB -- hold until publication | Title: | The crystal structure of an anti-HIV_scFv design with disulfide bonds eliminated | Authors: | Chen, S.H., Snow, C.D., Deroo, J.B., Zhao, N. | Deposition date: | 2025-02-10 |
|
PDBID: | 9n8y | Status: | HPUB -- hold until publication | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649 | Authors: | Marx, D.C., Levitz, J.T. | Deposition date: | 2025-02-10 |
|
PDBID: | 9n8z | Status: | HPUB -- hold until publication | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649, class 2 | Authors: | Marx, D.C., Levitz, J.T. | Deposition date: | 2025-02-10 |
|
PDBID: | 9n90 | Status: | HPUB -- hold until publication | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4, in the presence of PAM VU6005649 and Beta-Arrestin 1, class 1 | Authors: | Marx, D.C., Levitz, J.T. | Deposition date: | 2025-02-10 |
|