| PDBID: | 9nkd | | Status: | HPUB -- hold until publication | | Title: | Dpo4 DNA polymerase (R332A) in complex with DNA containing an 8oxoG template lesion | | Authors: | Pata, J.D., Liang, B. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9nkc | | Status: | HPUB -- hold until publication | | Title: | Dpo4 DNA polymerase (Wild Type) in complex with DNA containing an 8oxoG template lesion | | Authors: | Pata, J.D., Liang, B. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9qal | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Solution NMR structure of Arkadia 2 RING domain | | Authors: | Marousis, K.D., Giannari, D., Seliami, A., Politi, M., Birkou, M., Bentrop, D., Episkopou, V., Spyroulias, G.A. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9nin | | Status: | HPUB -- hold until publication | | Title: | The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-86 | | Authors: | Cartwright, J.J., Abiodun, W.O., Dass, R., Singleton, J.D., Doukov, T., Peterson, M.A., Moody, J.D. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9t | | Status: | HPUB -- hold until publication | | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9m1i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the TBC-D-Arl2-beta-tubulin complex | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q8r | | Status: | HPUB -- hold until publication | | Title: | Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-25 | | Sequence: | >Entity 1
GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
|
|
| PDBID: | 9q8y | | Status: | HPUB -- hold until publication | | Title: | Structure of RNF38 RING with linchpin mutant R454Y in complex with Ubch5B-Ub | | Authors: | Gabrielsen, M., Buetow, L., Huang, D.T. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m0b | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of alpha-agarase AGA from Catenovulum maritimum | | Authors: | Zhang, X.M., Li, W.H., Han, X.D. | | Deposition date: | 2025-02-24 | | Release date: | 2026-02-24 |
|
| PDBID: | 9m0a | | Status: | HPUB -- hold until publication | | Title: | Structure of TqaM from Penicillium aethiopicum in complex with D-(+)-3-phenyllactic acid | | Authors: | Wang, H., Mori, T., Abe, I. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9lzl | | Status: | HPUB -- hold until publication | | Title: | Flat-contact of Flock House Virus early disassembly intermediate | | Authors: | Lokshman, M.K., Kumar, D., Borkotoky, S., Banerjee, M. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9lzw | | Status: | HPUB -- hold until publication | | Title: | Bent-contact of Flock House Virus early disassembly intermediate | | Authors: | Lokshman, M.K., Kumar, D., Borkotoky, S., Banerjee, M. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9igt | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Assembly intermediate of human mitochondrial ribosome small subunit bound to METTL15, RBFA, and mtIF2 (State M2.1) | | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9igu | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Assembly intermediate of human mitochondrial ribosome small subunit bound to METTL15 and RBFA (Inward conformation) (State M2) | | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9ig9 | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and compound 3 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ndd | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer, combined core plus aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndv | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) local refinement of aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndw | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) local refinement of core | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndx | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) refinement of aptamer and core | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with DK-2 | | Authors: | Gray, J.L., Zaidman, D., Callens, M.C., von Delft, F., London, N., Brennan, P.E. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifv | | Status: | HPUB -- hold until publication | | Title: | PARP15 catalytic domain mutant (R576E) in complex with 3-aminobenzamide | | Authors: | Ebenwaldner, C., Logan, D.T., Schuler, H., Moche, M. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifm | | Status: | HPUB -- hold until publication | | Title: | STRUCTURE OF UNSTACKED C2S2-TYPE PSII-LHCII SUPERCOMPLEX FROM PISUM SATIVUM | | Authors: | Klaiman, D., Fadeeva, M., Kandiah, E., Nelson, N. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ig1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with DK-652 | | Authors: | Gray, J.L., Zaidman, D., Callens, M.C., von Delft, F., London, N., Brennan, P.E. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ift | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifu | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and compound 1 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
