| PDBID: | 9d18 | | Status: | HPUB -- hold until publication | | Title: | Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in detergent-conformation 2 of inactivating domain | | Authors: | Agarwal, S., Nimigean, C. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9d19 | | Status: | HPUB -- hold until publication | | Title: | Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in detergent-conformation 3 of inactivating domain | | Authors: | Agarwal, S., Nimigean, C. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9j2l | | Status: | HPUB -- hold until publication | | Title: | 4,5-DOPA-extradiol-dioxygenase from Mirabilis jalapa | | Authors: | Chou, Y.C., Hsu, C.H. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9gdj | | Status: | HPUB -- hold until publication | | Title: | C-Methyltransferase SgMT from Streptomyces griseoviridis | | Authors: | Weiergraeber, O.H., Haase, M., Pietruszka, J. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9czj | | Status: | HPUB -- hold until publication | | Title: | Ca2+ free hSlo1 + beta2N-beta4 channel in detergent. | | Authors: | Agarwal, S., Nimigean, C. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9czk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ca2+ free hSlo1 + beta2N-beta4 channel in nanodisc. | | Authors: | Agarwal, S., Nimigean, C. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9czm | | Status: | HPUB -- hold until publication | | Title: | Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in nanodisc. | | Authors: | Agarwal, S., Nimigean, C. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9cze | | Status: | HPUB -- hold until publication | | Title: | High-Resolution Structure of Human DHODH for Molecular Replacement in Fragment Screening Campaign | | Authors: | Purificacao, A.D., Benz, L.S., Froes, T.Q., Weiss, M.S., Nonato, M.C. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gcl | | Status: | HPUB -- hold until publication | | Title: | Structure of the U11 snRNP C-lobe | | Authors: | Jiangfeng, Z., Wojciech, G. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcp | | Status: | HPUB -- hold until publication | | Title: | ChREBP/14-3-3 complex stabilized by AMP | | Authors: | Moschref, M., Heimhalt, M., Pysik, T., Menzer, W.M., Basquin, J., Margulies, C.E., Ladurner, A.G. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gc1 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND8 | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
| PDBID: | 9gc9 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND27 | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
| PDBID: | 9gcc | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND47 | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
| PDBID: | 9gcd | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH Fulacimstat (COMPOUND86) | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
| PDBID: | 9cy8 | | Status: | HPUB -- hold until publication | | Title: | Constrained b-hairpins targeting the EphA4 ligand binding domain | | Authors: | Muzzarelli, K.M., Assar, Z., Prentis, A.M., Baggio, C., Pellecchia, M. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9iz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus complexed with C37 Fab, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gbm | | Status: | HPUB -- hold until publication | | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG3 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbn | | Status: | HPUB -- hold until publication | | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG15 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbo | | Status: | HPUB -- hold until publication | | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG16 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbh | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND1 | | Authors: | Schaefer, M., Fuerstner, C., Ackerstaff, J., Meier, H., Straub, A., Mittendorf, J., Schamberger, J., Boerngen, K., Joerissen, H., Zubow, D., Zimmermann, K., Tersteegen, A., Geiss, V., Hartmann, E., Albrecht-Kuepper, B., Dorleans-Juste, P., Lapointe, C., Vincent, L., Heitmeier, S., Tinel, H. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iz1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | dmCTPS tetramer with dATP dUTP dGTP and DON | | Authors: | Guo, C.J., Liu, J.L. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iz2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Focus refinement dmCTPS bound with dATP dUTP dGTP and DON | | Authors: | Guo, C.J., Liu, J.L. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Complement Factor H central CCP domains 8-14 in complex with the cyclic peptide 5C6 | | Authors: | Monecke, T., Schmidt, C.Q., Niessing, D. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9iyd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of an amyloid fibril formed by SOD1 mutant - G93A | | Authors: | Zhang, M.Y., Ma, Y.Y., Wang, L.Q., Xia, W.C., Yuan, H.Y., Zhao, K., Chen, J., Li, D., Zou, L.Y., Wang, Z.Z., Liu, C., Liang, Y. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9iyi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus complexed with C34 Fab, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-07-30 |
|
