| PDBID: | 9opm | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro S147A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-05-19 |
|
| PDBID: | 9opp | | Status: | HPUB -- hold until publication | | Title: | HLA-A*02:01 SCT with Cathepsin G peptide, FLLPTGAEA | | Authors: | Finton, K.A.K. | | Deposition date: | 2025-05-19 |
|
| PDBID: | 9r9c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TRIM24 PHD-bromodomain with XS839112 | | Authors: | Mavridi, D., Peng, H., Halabelian, L., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-05-19 |
|
| PDBID: | 9v0l | | Status: | HPUB -- hold until publication | | Title: | UDP-binding PsBGluT, a tetrahydrobiopterin glucosyltransferase from Pseudanabaena sp. Chao 1811 | | Authors: | Zang, R.J., Jiang, Y.L., Zhou, C.Z. | | Deposition date: | 2025-05-18 |
|
| PDBID: | 9uz6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of E. coli glycine decarboxylase (P-protein) apo | | Authors: | Han, Z., Zeng, A. | | Deposition date: | 2025-05-16 | | Release date: | 2026-05-16 |
|
| PDBID: | 9op3 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human ADAR2-R2D complexed with dsRNA containing 8-azaN and 2''-Deoxy-2''-fluorouridine | | Authors: | Campbell, K.B., Ouye, R.B., Wong, B.L., Jiang, A., Okada, K., McKenney, R.J., Fisher, A.J., Beal, P.A. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9oov | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the heterotrimeric complex formed by two subunits of YrvO and a subunit of MnmA bound to tRNA-Glu | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-16 | | Release date: | 2025-11-16 |
|
| PDBID: | 9oow | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the heterotetrameric complex formed by two subunits of YrvO and two subunits of MnmA bound to tRNA-Glu | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-16 | | Release date: | 2025-11-16 |
|
| PDBID: | 9r8s | | Status: | HPUB -- hold until publication | | Title: | A viral SAVED protein with ring nuclease activity subverts type III CRISPR defence | | Authors: | McMahon, S.A., White, M.F., Orzechowski, M., Hoikkala, V., Chi, H., Gloster, T.M. | | Deposition date: | 2025-05-16 | | Sequence: | >Entity 1
GANAMAHMIGVYITKWGFEVETFKKALPKNTEVKTIAFTGDWIEAVRQFYSTVKEIDGHIHLALNGPSSLAFGCGVIFGSLKTFSFWHYQNGAYHTIPITNVRALKQRLKQYNYVEPFYEAGGKDLVVMLNYSHHEIKTAVKEYVMNKLRLENPSYLEISLKGITGNIPIELMPTVANETSSLLQDVKKHQSFDRFHFFFSCPVPIAFMVGVAFGLYDELVVYNFSGTYEPVLSFKDLKEVKL
|
|
| PDBID: | 9r8p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of hSA3, a mutated hyper-soluble human serum albumin designed for bacterial expression | | Authors: | De Felice, S., Cendron, L. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r88 | | Status: | HPUB -- hold until publication | | Title: | CTE Type I tau filament from the brain of a football player | | Authors: | Qi, C., Scheres, H.W.S., Goedert, M. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r89 | | Status: | HPUB -- hold until publication | | Title: | CTE Type II tau filament from the brain of a football player | | Authors: | Qi, C., Scheres, H.W.S., Goedert, M. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r8a | | Status: | HPUB -- hold until publication | | Title: | PHF tau filament from the brain of a football player | | Authors: | Qi, C., Scheres, H.W.S., Goedert, M. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r8d | | Status: | HPUB -- hold until publication | | Title: | SF tau filament from the brain of a football player | | Authors: | Qi, C., Scheres, H.W.S., Goedert, M. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r8o | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Open-state RyR1 in 0.05% POPC micelles, in complex with a nanobody and FKBP | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9uyr | | Status: | HPUB -- hold until publication | | Title: | In situ structure of egg-white lysozyme using a goniometer-compatible chip-based platform | | Authors: | Ghosh, S. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9uyu | | Status: | HPUB -- hold until publication | | Title: | Egg-white lysozyme at cryogenic temperature using a goniometer-compatible chip-based platform | | Authors: | Ghosh, S. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9uyt | | Status: | HPUB -- hold until publication | | Title: | DNA duplex containing gold-mediated 2-thio-cytosine base pairs | | Authors: | Kondo, J., Kosugi, K., Sugawara, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9oo6 | | Status: | HPUB -- hold until publication | | Title: | Human PORCN bound to inhibitor C59 | | Authors: | Black, K.A., Venugopal, H., Glukhova, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9onx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Full length LRRK2 active form 2 (class8) | | Authors: | Villagran-Suarez, A., Leschziner, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9oo7 | | Status: | HPUB -- hold until publication | | Title: | Human PORCN bound to inhibitor ETC159 | | Authors: | Black, K.A., Venugopal, H., Glukhova, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9oo8 | | Status: | HPUB -- hold until publication | | Title: | Apo Human PORCN | | Authors: | Black, K.A., Venugopal, H., Glukhova, A. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9oo5 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the dimeric YrvO cysteine desulfurase | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-15 | | Release date: | 2025-11-15 |
|
| PDBID: | 9ooa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MYST acetyltransferase domain in complex with inhibitor 7 | | Authors: | Hermans, S.J., Suwandi, A., Parker, M.W., Baell, J.B. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9ont | | Status: | HOLD -- hold until a certain date | | Title: | Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol hexakisphosphate | | Authors: | Cleland, C.P., Mosimann, S.C. | | Deposition date: | 2025-05-15 | | Release date: | 2025-11-15 |
|
