| PDBID: | 9ws7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of cofactor-free full-length Tau P301S fibrils | | Authors: | Zhang, G., Li, X., Liu, C. | | Deposition date: | 2025-09-12 | | Release date: | 2026-09-12 |
|
| PDBID: | 9wsa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of cofactor-free PHF-like FL-P301S/3R mixed Tau fibrils Type 1 | | Authors: | Zhang, G., Li, X., Liu, C. | | Deposition date: | 2025-09-12 | | Release date: | 2026-09-12 |
|
| PDBID: | 9wsb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of cofactor-free PHF-like FL-P301S/3R mixed Tau fibrils Type 2 | | Authors: | Zhang, G., Li, X., Liu, C. | | Deposition date: | 2025-09-12 | | Release date: | 2026-09-12 |
|
| PDBID: | 9sob | | Status: | PROC -- to be processed | | Title: | Structural Model of the Nuclear Pore Complex in Arabidopsis thaliana | | Authors: | Obarska-Kosinska, A., Sanchez Carrillo, I.B., Hoffmann, P.C., Fourcassie, V., Beck, M., Germain, H. | | Deposition date: | 2025-09-12 |
|
| PDBID: | 9wrc | | Status: | PROC -- to be processed | | Title: | Crystal structure of ZER1 bound to MHGD degron | | Authors: | Dong, C., Ma, J., Li, J. | | Deposition date: | 2025-09-11 | | Release date: | 2026-09-11 |
|
| PDBID: | 9y7v | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT bound to coenzyme A in a hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y7y | | Status: | HPUB -- hold until publication | | Title: | KRAS-specific 24-246 TCR in complex with HLA-C*01:02 presenting KRAS G12V 9mer peptide (11-AVGVGKSAL-19) | | Authors: | Miller, H.A., Palowitch, G.M., Dulberger, C.L. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9sn9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of anthocyanin-related glutathione transferase from bilberry in complex with glutathione | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 |
|
| PDBID: | 9sn8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from bilberry | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
MVVKVYGSIRAACPQRVMVCLLEMGVDFELIPVDLESGEHKKPEFLLRQPFGQVPAIEDGDFRLFESRAIIRYYAAKYADYGPNLLGTTLEERALVDQWLEVEAHNFNDLVYNLVLQLVILPRMGERSDLALVSTCENKLEKVLDIYEQRLSKSNYLAGESFTLADLSHLPAIRYLMDEAGLGHMVRNRKNVNSWWMDISSRPAWKKIMKLMD
|
|
| PDBID: | 9sn7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from poplar in complex with quercetin | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
VVKVYGPAMAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDGDFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVILPRIGQQGDSELVRTYEEKLEKVLDVYEQRLSKSKYLAGDSFTLADLSHLPATRYLVNEAGLGHLVKDRKKLNAWWEDISSRPAWKKLINLAGF
|
|
| PDBID: | 9y79 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC^walked) containing mRNA with a 39 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Shandilya, S., Wang, C., Molodtsov, V., Ebright, R.H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y6t | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT in a hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y72 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT in a two-hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y6o | | Status: | PROC -- to be processed | | Title: | Structure of fimbriae-like lipoprotein by Cryo Electron Microscopy | | Authors: | Hanssen, E., Gorasia, D.G., Reynolds, E.C. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y74 | | Status: | PROC -- to be processed | | Title: | [22L-7B AC] L-DNA 22 bp tensegrity triangle that propagates via blunt-end stacking with A stacking on C at the interface | | Authors: | Horvath, A., Woloszyn, K., Vecchioni, S., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y76 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the human DCAF1 WDR domain in complex with OICR-40120 | | Authors: | kimani, S., Dong, A., Li, Y., Seitova, A., Mamai, A., Al-awar, R., Ackloo, S., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9wpb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human transthyretin (TTR) with pryazole-based stabilizer | | Authors: | Choe, J., Choi, S., Shin, H.-C. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wp4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of phosphate binding protein from Synechocystis sp. PCC 6803 | | Authors: | Wang, C.Y., Lu, Y.P., Ma, H.L. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wp7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of phosphate binding protein(SphX) from Synechocystis sp. PCC 6803 | | Authors: | Wang, C.Y., Lu, Y.P., Ma, H.L. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wp6 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The cryo-EM structure of Zea mays GLN1 | | Authors: | Wu, X.X., Cheng, Y.Q., Zhang, Y., Huang, Y.C. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9y68 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Full length LRRK2 (G2019S) after symmetry expansion | | Authors: | Villagran Suarez, A.C., Bodrug, T. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9y67 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Full length LRRK2 after symmetry expansion | | Authors: | Villagran Suarez, A.C., Bodrug, T. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9y65 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Plasmodium falciparum M1 aminopeptidase (PfA-M1) bound to inhibitor 3k (MIPS3415) | | Authors: | Mansouri, M., McGowan, S., Webb, C.T. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wox | | Status: | PROC -- to be processed | | Title: | rystal Structure of the MLH1 Protein Bound to the FAN1 Peptide (124-131) | | Authors: | Chen, Y.C., Liu, Y.L., Shang, X.C. | | Deposition date: | 2025-09-07 |
|
| PDBID: | 9woy | | Status: | PROC -- to be processed | | Title: | rystal Structure of the MLH1 Protein Bound to the FAN1 Peptide (145-163) | | Authors: | Chen, Y.C., Liu, Y.L., Shang, X.C. | | Deposition date: | 2025-09-07 |
|
