| PDBID: | 9svw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with S2.6 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9x0j | | Status: | HPUB -- hold until publication | | Title: | IL-33 and Etokimab fab and Tozorakimab fab ternary complex structure | | Authors: | Wang, X.Q., Wang, Y. | | Deposition date: | 2025-09-30 |
|
| PDBID: | 9sv4 | | Status: | HPUB -- hold until publication | | Title: | The ternary complex of human sirt6, ADPr and small molecule activator. | | Authors: | Moche, M., Andersson, O., Nyman, T., Strandback, E., Ampah-Korsah, H., Colquhoun, D., Spahr, H. | | Deposition date: | 2025-09-30 |
|
| PDBID: | 9x05 | | Status: | HPUB -- hold until publication | | Title: | IL-33 and Itepekimab fab and Tozorakimab fab ternary complex structure | | Authors: | Wang, X.Q., Wang, Y. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9yfz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | KrkA D193C ternary complex | | Authors: | Govind, M., Kimber, M.S. | | Deposition date: | 2025-09-27 |
|
| PDBID: | 9wxx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Free Ana-Thanatin in Free Solution | | Authors: | Abdullah, S.J., Bhattacharyya, S. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9yf6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of vaccine-elicited V3-targeting antibody BHG0-4 Fab bound to CH505TFchim.6R.SOSIP.664 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9yf7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of vaccine-elicited V3-targeting antibody BHG0-5 Fab bound to CH505TFchim.6R.SOSIP.664 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ss7 | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme C-domain in complex with rentiapril | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 | | Sequence: | >Entity 1
EAEASKFVEEYDRTSQVVWNEYAGANWNYNTNITTETSKILLQKNMQIAQHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPQGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWQKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPQMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPN
|
|
| PDBID: | 9ss8 | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme N-domain in complex with rentiapril | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ss9 | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme N-domain in complex with captopril | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssa | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme C-domain in complex with zofenoprilat | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssb | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme N-domain in complex with zofenoprilat | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wwk | | Status: | HPUB -- hold until publication | | Title: | IL-33/ST2/IL-1RAcP ternary complex structure | | Authors: | Wang, X.Q., Wang, Y. | | Deposition date: | 2025-09-23 |
|
| PDBID: | 9wwd | | Status: | HPUB -- hold until publication | | Title: | A ternary complex of CEPR2 with BAK1 and CEP4 | | Authors: | Bai, Y.F., Yu, J.F., Xiao, Y. | | Deposition date: | 2025-09-23 |
|
| PDBID: | 9wwh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IL-33 and antibody Tozorakimab fab binary complex | | Authors: | Wang, X.Q., Chen, J., Wang, Y. | | Deposition date: | 2025-09-23 |
|
| PDBID: | 9sqs | | Status: | HPUB -- hold until publication | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with S2.2 | | Authors: | Sacarin, R., Rojas, L.A., Millet, O. | | Deposition date: | 2025-09-23 |
|
| PDBID: | 9ydb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Eukaryotic pre-60S ribosomes from uL16 P-site loop mutants in bypass condition. Lsg1,Nmd3 and Tif6 present | | Authors: | Guan, K., Taylor, D.W. | | Deposition date: | 2025-09-22 |
|
| PDBID: | 9ydc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Eukaryotic 80S ribosome with A/P, P/E tRNAs from uL16 P-site loop mutants in bypass condition | | Authors: | Guan, K., Taylor, D.W. | | Deposition date: | 2025-09-22 |
|
| PDBID: | 9ydd | | Status: | HPUB -- hold until publication | | Title: | Eukaryotic 80S ribosome with A/A, P/P tRNAs from uL16 P-site loop mutants in bypass condition | | Authors: | Guan, K., Taylor, D.W. | | Deposition date: | 2025-09-22 |
|
| PDBID: | 9yde | | Status: | HPUB -- hold until publication | | Title: | Eukaryotic 80S ribosome with P/P tRNA from uL16 P-site loop mutants in bypass condition | | Authors: | Guan, K., Taylor, D.W. | | Deposition date: | 2025-09-22 |
|
| PDBID: | 9yd2 | | Status: | HPUB -- hold until publication | | Title: | Ternary complex of DNA polymerase I from Bacillus stearothermophilus, large fragment, bound to DNA containing a thymine dimer and dATP | | Authors: | Wu, E.Y., Walsh, A.R. | | Deposition date: | 2025-09-20 |
|
| PDBID: | 9wvb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | A ternary complex of RLK7 with BAK1 and TOSL2 | | Authors: | Bai, Y.F., Yu, J.F., Xiao, Y. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9ycc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Pt012-UD.B37B_SOSIP.6R.664 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9ycb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Pt012-UD.B42A_SOSIP.6R.664 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2025-09-18 |
|
