| PDBID: | 9eqz | | Status: | HPUB -- hold until publication | | Title: | 53fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9er0 | | Status: | HPUB -- hold until publication | | Title: | 53fs pulse duration 50uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9er1 | | Status: | HPUB -- hold until publication | | Title: | 53fs pulse duration 100uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9erg | | Status: | HPUB -- hold until publication | | Title: | Uhgb_MS mannoside synthase from an unknown human gut bacterium in complex with Mannose-1-Phosphate | | Authors: | Cioci, G., Ladeveze, S., Potocki-Veronese, G. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqr | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 50uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9b2n | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of the quorum quenching lactonase GcL D122N mutant - monometal center | | Authors: | Corbella, M., Bravo, J.A., Demkiv, A.O., Calixto, A.R., Sompiyachoke, K., Bergonzi, C., Kamerlin, S.C.L., Elias, M. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b26 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cod allergen Gad m 1.0201 coordinating lanthanum | | Authors: | O''Malley, A., Chruszcz, M. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b14 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human uMtCK1 in complex with transition state analog | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9b16 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human uMtCK1 in complex with ADP and covalent inhibitor CKi | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9b0t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E227Q variant of uMtCK1 in complex with transition state analog | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-12 |
|
| PDBID: | 9b0u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E227Q variant of uMtCK1 incubated with ADP and phosphocreatine at pH 8.0 | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-12 |
|
| PDBID: | 9b05 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human uMtCK1 | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-11 |
|
| PDBID: | 9awy | | Status: | HPUB -- hold until publication | | Title: | Structure of full-length amyloidogenic immunoglobulin light chain H9 in complex with 3-(2-(4-(3-ethyl-3-phenylpyrrolidin-1-yl)-6-methyl-2-oxopyridin-1(2H)-yl)ethyl)-8-(imidazo[1,5-a]pyrazin-8-yl)-1,3,8-triazaspiro[4.5]decan-2-one | | Authors: | Lederberg, O.L., Kelly, J.W., Yan, N.L., Wilson, I.A., Stanfield, R.L. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9ax1 | | Status: | HPUB -- hold until publication | | Title: | Structure of full-length amyloidogenic immunoglobulin light chain H9 in complex with 2-(6-methyl-2-oxo-4-(2-phenylpropoxy)pyridin-1(2H)-yl)ethyl (3-(1H-imidazol-4-yl)benzyl)carbamate | | Authors: | Lederberg, O.L., Yan, N.L., Stanfield, R.L., Wilson, I.A., Kelly, J.W. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 8s7f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Escherichia coli LpxH in complex with EBL-2805 | | Authors: | Sooriyaarachchi, S., Mowbray, S.L., Bergfors, T., Jones, T.A. | | Deposition date: | 2024-03-01 | | Sequence: | >Entity 1
MATLFIADLHLCAEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHHQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQTLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQTAFRVVLGAWHTEGSMVKVTADDVELIHFPFHHHHHH
|
|
| PDBID: | 8w1v | | Status: | HPUB -- hold until publication | | Title: | The beta2 adrenergic receptor bound to a bitopic ligand | | Authors: | Gaiser, B., Danielsen, M., Xu, X., Jorgensen, K., Fronik, P., Marcher-Rorsted, E., Wrobe, T., Hirata, K., Liu, X., Mathiesen, J., Pedersen, D. | | Deposition date: | 2024-02-19 |
|
| PDBID: | 8ryl | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The structure of thiocyanate dehydrogenase from Pelomicrobium methylotrophicum in complex with the substrate analogue selenocyanate (SeCN-) | | Authors: | Varfolomeeva, L.A., Polyakov, K.M., Shipkov, N.S., Dergousova, N.I., Boyko, K.M., Tikhonova, T.V., Popov, V.O. | | Deposition date: | 2024-02-09 |
|
| PDBID: | 8rxm | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Galectin-3 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2024-02-07 |
|
| PDBID: | 8rwl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Methanopyrus kandleri malate dehydrogenase mutant 1 | | Authors: | Coquille, S., Roche, J., Engilberge, S., Girard, E., Madern, D. | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rs5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Methanopyrus kandleri malate dehydrogenase mutant 4 | | Authors: | Coquille, S., Engilberge, S., Madern, D. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rrs | | Status: | HPUB -- hold until publication | | Title: | Structure of mouse RyR2 solubilised in detergent in open state in complex with Ca2+, ATP, caffeine and Nb9657. | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8rov | | Status: | HPUB -- hold until publication | | Title: | Human dectin-2 with dimerization domain | | Authors: | Liu, Y., Kim, J.W., Feinberg, H., Cull, N., Weis, W.I., Taylor, M.E., Drickamer, K. | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8vlt | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of glycan-targeting antibody 2526 Fab bound to Mannose | | Authors: | Lindenberger, J., Acharya, P. | | Deposition date: | 2024-01-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8xr7 | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
