| PDBID: | 8kck | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N9 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 | | Sequence: | >Entity 1
GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
| PDBID: | 8kc5 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T09 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc4 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NA05 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc8 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T11 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8kc0 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NB8 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8kc1 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NX5 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8ka6 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NA7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-02 |
|
| PDBID: | 8ka7 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NB7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-02 |
|
| PDBID: | 8kac | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NX1 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-02 |
|
| PDBID: | 8k8i | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N14 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-07-30 |
|
| PDBID: | 8k8f | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-07-29 |
|
| PDBID: | 8k8g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | De novo design protein -N9 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-07-29 |
|
| PDBID: | 8k84 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N3 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-07-28 |
|
| PDBID: | 8k83 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N2 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-07-28 |
|
| PDBID: | 8k7z | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N1 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-07-27 |
|
| PDBID: | 8k7o | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T03 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-07-27 |
|
| PDBID: | 8k7m | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T01 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-07-26 |
|
| PDBID: | 8tbc | | Status: | HPUB -- hold until publication | | Title: | Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg | | Authors: | Abhiraman, G.C., Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-28 |
|
