| PDBID: | 9eos | | Status: | HPUB -- hold until publication | | Title: | Human serum albumin with myristate | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLL
|
|
| PDBID: | 9b25 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the ER-alpha Ligand-binding Domain (L372S, L536S) in complex with NA98 | | Authors: | Nwachukwu, J.C., Min, C.K., Papa, A., Rangarajan, E.S., Izard, T., Sharma, A., Nettles, K.W. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b2b | | Status: | HPUB -- hold until publication | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with a Complete Estrogen Receptor Antagonists that Favors Tetramer Formation | | Authors: | Fink, E.C., Chawla, R., Wells, K.S., Barratt, S., Myles, D.C., Pena, G., Robello, B.W., Ng, R., Fanning, S.W. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9eo3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of tyrosinase (WT) from Bacillus megaterium soaked in Cu(II) | | Authors: | Englund, A.N.B., Rohr, A.K., Dalleywater, E.L. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9eod | | Status: | HPUB -- hold until publication | | Title: | Human serum albumin with adamantene carboxylic acid | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-03-14 | | Sequence: | >Entity 1
MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLL
|
|
| PDBID: | 9b14 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human uMtCK1 in complex with transition state analog | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9b16 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human uMtCK1 in complex with ADP and covalent inhibitor CKi | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9b15 | | Status: | HPUB -- hold until publication | | Title: | Superfamily 2 helicase Hel308 containing the beta-hairpin from DNA pol theta helicase-like domain | | Authors: | Eckenroth, B.E., Doublie, S. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9enr | | Status: | HPUB -- hold until publication | | Title: | Vitellogenin from the honey bee hemolymph | | Authors: | Montserrat-Canals, M., Schnelle, K., Moeller, A., Cunha, E., Luecke, H. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9b0t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E227Q variant of uMtCK1 in complex with transition state analog | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-12 |
|
| PDBID: | 9b0u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E227Q variant of uMtCK1 incubated with ADP and phosphocreatine at pH 8.0 | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-12 |
|
| PDBID: | 9b05 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human uMtCK1 | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-11 |
|
| PDBID: | 9b0a | | Status: | HPUB -- hold until publication | | Title: | GA10 nanobody bound to 2C7 peptide mimitope of Neisseria gonorrhoeae lipooligosaccharide | | Authors: | Williamson, A., Walker, E., Kelton, W., Hicks, J. | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8s8p | | Status: | HPUB -- hold until publication | | Title: | Restriction on Ku Inward Translocation Caps Telomere Ends | | Authors: | Mattarocci, S., Baconnais, S., Roisne-Hamelin, F., Pobiega, S., Alibert, O., Morin, V., Deshayes, A., Veaute, X., Ropars, V., Mazon, G., Busso, D., Fernandez Varela, P., Le Cam, E., Charbonnier, J., Cuniasse, P., Marcand, S. | | Deposition date: | 2024-03-07 |
|
| PDBID: | 9aw5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Yeast 20S proteasome soaked with MA9 fraction E/F | | Authors: | Meneghello, R., Rustiguel, J.K., Fernandes, A.Z.N., Trivella, D.B.B. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 8s82 | | Status: | HPUB -- hold until publication | | Title: | Restriction on Ku Inward Translocation Caps Telomere Ends | | Authors: | Mattarocci, S., Baconnais, S., Roisne-Hamelin, F., Pobiega, S., Alibert, O., Morin, V., Deshayes, A., Veaute, X., Ropars, V., Mazon, G., Busso, D., Fernandez Varela, P., Le Cam, E., Charbonnier, J., Cuniasse, P., Marcand, S. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 8s7m | | Status: | HPUB -- hold until publication | | Title: | RosC(R33A) - riboflavin complex | | Authors: | Ermler, U., Mack, M., Warkentin, E. | | Deposition date: | 2024-03-04 |
|
| PDBID: | 8yjs | | Status: | HPUB -- hold until publication | | Title: | endogenous state E PCNA-DNA-FEN1 complex | | Authors: | Tian, Y., Gao, N. | | Deposition date: | 2024-03-02 |
|
| PDBID: | 9av1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli GuaB dCBS with inhibitor GNE9123 | | Authors: | Harris, S.F., Wu, P. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9aug | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3.G57R | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9auh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9aui | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA4 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s75 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC FL412 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s76 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF67 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s77 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF234 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
