| PDBID: | 9v8o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Influenza A/H5N6 polymerase symmetric dimer in termination state bound vRNA promoter | | Authors: | Wang, A.J., Liao, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ovf | | Status: | HPUB -- hold until publication | | Title: | Rubredoxin covalently linked to benzo-18-crown-6 | | Authors: | Adhami, N., Sawaya, M.R., Shafaat, H.S., Rodriguez, J.A., Spokoyny, A.M. | | Deposition date: | 2025-05-29 | | Sequence: | >Entity 1
MQKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSPA
|
|
| PDBID: | 9oup | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ous | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | D3 Virion icos | | Authors: | Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9our | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9oum | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta1-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9oun | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouz | | Status: | HPUB -- hold until publication | | Title: | Icosahedral D3 expanded capsid | | Authors: | Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v7k | | Status: | HPUB -- hold until publication | | Title: | Phycobilisome allophycocyanin hexamer C from Gloeobacter violaceus PCC 7421 | | Authors: | Burtseva, A.D., Baymukhametov, T.N., Slonimskiy, Y.B., Popov, V.O., Sluchanko, N.N., Boyko, K.M. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9ou2 | | Status: | HPUB -- hold until publication | | Title: | K-Ras Wild Type 1-169 Bound to BI-2865 at 100 K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9oui | | Status: | HPUB -- hold until publication | | Title: | K-Ras G12D 1-169 bound to MRTX-1133 at 313 K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9oua | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Netrin-1 (NET1) in complex with UNC5B | | Authors: | Rafiei, F., Gupta, M., Bailey-Elkin, B.A., Koch, M., Stetefeld, J. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9ou8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hUGDH Dimer-A104L/A136M complexed with UDP-Xyl | | Authors: | Kadirvelraj, R., Wood, Z.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9ouc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Influenza A Virus Nucleoprotein(8-498)NP complex with 5-(4-(morpholinomethyl)phenyl)-2-oxo-6-(trifluoromethyl)-1,2-dihydropyridine-3-carboxamide (Compound 3) | | Authors: | Mamo, M. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9oug | | Status: | HPUB -- hold until publication | | Title: | Influenza A Virus Nucleoprotein(8-498)NP complex with rac-5-(4-(((2R,6R)-6-(methoxymethyl)-6-methyl-1,4-dioxan-2-yl)methoxy)phenyl)-2-oxo-6-(trifluoromethyl)-1,2-dihydropyridine-3-carboxamide (Compound 20) | | Authors: | Mamo, M. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9ou3 | | Status: | HPUB -- hold until publication | | Title: | K-Ras Wild Type 1-169 bound to BI-2865 at 293K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9ouh | | Status: | HPUB -- hold until publication | | Title: | K-Ras G12D Cysteine Light at 293 K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9v69 | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of the two-electron reduced form of wild type b5R | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6a | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of the T66V mutant b5R co-crystallized with NADH | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6b | | Status: | HPUB -- hold until publication | | Title: | Neutron crystal structure of the oxidized form of b5R at pD 6.5 | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6c | | Status: | HPUB -- hold until publication | | Title: | Neutron crystal structure of the oxidized form of b5R at pD 7.5 | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6f | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of a ThDP-dependent enzyme PpBFD | | Authors: | Hou, X.L., Zhou, J.H. | | Deposition date: | 2025-05-27 |
|
