| PDBID: | 9qry | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs4 | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | One ring nuclease to rule them all: the CRISPR-associated enzyme Crn4 degrades all cyclic oligoadenylate signalling species | | Authors: | McMahon, S.A., Chi, H., Hoikkala, V., Gloster, T.M., White, M.F. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qru | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsa | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome rotated-1 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs0 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-04 | | Release date: | 2026-04-04 |
|
| PDBID: | 9qs7 | | Status: | HOLD -- hold until a certain date | | Title: | AcuB,Acetoin utilization protein | | Authors: | Zheng, L.J., Bange, G. | | Deposition date: | 2025-04-04 | | Release date: | 2026-04-04 |
|
| PDBID: | 9qs2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zika Virus NS2B-NS3 protease in complex with Z100582766 | | Authors: | Benz, L.S., Becker, F., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrw | | Status: | HPUB -- hold until publication | | Title: | S.aureus ClpC dodecameric resting state | | Authors: | Engelhardt, L., Carroni, M. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrt | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor; L323A mutant) bound to FAD and NAD+ and compound 2 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs1 | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsb | | Status: | HPUB -- hold until publication | | Title: | The solution structure of the cyanobacterial calcium binding protein CSE at 293 K | | Authors: | Kleusberg, F., Scholl, J., Selim, K.A., Coles, M. | | Deposition date: | 2025-04-04 | | Sequence: | >Entity 1
GSSHHHHHHSSGLVPRGSHMATEQELQSLFNTLDRDQDGKISINELFLSPGLSAVISSETNTNSPQELLVQYDSDQDGSITFEELKKAVKKASNLT
|
|
| PDBID: | 9qs5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsd | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z854627136 | | Authors: | Becker, F., Benz, L.S., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qse | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z30008604 | | Authors: | Becker, F., Benz, L.S., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsf | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z2858787682 | | Authors: | Becker, F., Benz, L.S., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsg | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z1280094148 | | Authors: | Becker, F., Benz, L.S., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O. | | Deposition date: | 2025-04-04 |
|
