| PDBID: | 9o3a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3o | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3b | | Status: | HPUB -- hold until publication | | Title: | PKM2 bound to MCTI-566 | | Authors: | Stuckey, J.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3m | | Status: | HPUB -- hold until publication | | Title: | K40F mutant of hCRBPII bound to fentanyl | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTFVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
|
|
| PDBID: | 9o3p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qt4 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of Arabidopsis TIR-NLR WRR4A tetramer in complex with effector CCG40 (focused refinement) | | Authors: | Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an NtA622L variant in complex with NADP+ and Nicotinic acid | | Authors: | Mokos, D., Daniel, B. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsv | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
|
|
| PDBID: | 9qsr | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
|
|
| PDBID: | 9qt0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qt2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qss | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qst | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
|
|
| PDBID: | 9qsu | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
|
|
| PDBID: | 9qsq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mn(III)-substituted Wells-Dawson binding to Hen Egg-White Lysozyme (HEWL) | | Authors: | Moussawi, M.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qt3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9ud8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9ud7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human glutaminyl cyclase in complex with Inhibitor CL7 | | Authors: | Li, G.-B., Ning, X.-L., Meng, F.-B., Chen, Y.-T. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9ucx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9ucy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-06 |
|
