| PDBID: | 9o72 | | Status: | HPUB -- hold until publication | | Title: | Structure of turkey hemoglobin A covalently bound with epigallocatechin gallate | | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o70 | | Status: | HPUB -- hold until publication | | Title: | Motif1-Motif2, two domain left-handed parallel G-quadruplex | | Authors: | Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o73 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-30-035SRM | | Authors: | Brunzelle, J.S., Shuvalova, L., Roy, S.M., Watterson, D.M. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o74 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Mpro L115M in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o77 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-14 | | Release date: | 2026-04-14 |
|
| PDBID: | 9o76 | | Status: | HPUB -- hold until publication | | Title: | Recombinant AD THF complexed with SW-MK-NBD (Secondary Binding Site) | | Authors: | Kunach, P., Diamond, M.I. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o71 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-14 | | Release date: | 2026-04-14 |
|
| PDBID: | 9o78 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 I253M at pH 7.0 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o7a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 WT FC at pH 7.0 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwd | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of furin (PCSK3) in complex with the biphenyl-derived compound mi2470 | | Authors: | Dahms, S.O., Brandstetter, H. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | G7P7 Fab in complex with the VP1 pentamer of BK polyomavirus genotype II | | Authors: | Pedenko, B., Schoehn, G., Effantin, G., Poignard, P. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwa | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qwn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-14 | | Release date: | 2026-04-14 |
|
| PDBID: | 9qw3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepIII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepII-HepI-PhosI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic PhosII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qwl | | Status: | HPUB -- hold until publication | | Title: | Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343 | | Authors: | Sauer, U.H., Cisneros, D.A. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
(MSE)AFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILEN(MSE)TNQFKPHSGSIVFKKGDEEAK(MSE)KELTWENGYITEFTENIDIVGSQP(MSE)TITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH
|
|
| PDBID: | 9qwj | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-04-14 |
|
