| PDBID: | 9ueu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o55 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o5c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR solution structure of recombinantly synthesized tarantula toxin GsAF2 | | Authors: | Adhikary, K., Poget, S.F., Zhuang, J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o50 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of Thermus thermophilus SHMT in complex with tetrahydrofolate (THF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-09 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTH(LLP)TLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9o4z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o5a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o56 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o59 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o5b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RNase A in complex with N1-Methylpseudouridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o4x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtn | | Status: | HPUB -- hold until publication | | Title: | Human alpha7 nicotinic receptor in complex with the F1 nanobody | | Authors: | Barilone, N., Vangelatou, M., Marouf, F.Z., Dejean de la Batie, G., Ayme, G., Lafaye, P., Corringer, P.-J., Prevost, M.S. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qu1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qts | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Oceanobacillus iheyensis group II intron domains D1-D6 | | Authors: | Jadhav, S.S., Nigro, M., Marcia, M. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qty | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
