| PDBID: | 9su4 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-633 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9su5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-695 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9su6 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-705 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9su7 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-728 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 |
|
| PDBID: | 9su8 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-743 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9su9 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-753 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9sua | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-758 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9sub | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-768 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 |
|
| PDBID: | 9suc | | Status: | HOLD -- hold until a certain date | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0797 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9sud | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0801 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9sue | | Status: | HOLD -- hold until a certain date | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0802 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9suf | | Status: | HOLD -- hold until a certain date | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0807 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9sug | | Status: | HOLD -- hold until a certain date | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0822 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9suh | | Status: | HOLD -- hold until a certain date | | Title: | High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0830 | | Authors: | Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J. | | Deposition date: | 2025-09-27 | | Release date: | 2026-09-27 |
|
| PDBID: | 9ssm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 084-7D Fab bound to SARS-CoV-2 Beta RBD | | Authors: | Ayres, F., Moyo-Gwete, T., Wibmer, C.K. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9ss7 | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme C-domain in complex with rentiapril | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 | | Sequence: | >Entity 1 EAEASKFVEEYDRTSQVVWNEYAGANWNYNTNITTETSKILLQKNMQIAQHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPQGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWQKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPQMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPN
|
|
| PDBID: | 9ssa | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme C-domain in complex with zofenoprilat | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssd | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Penicillin G - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9sse | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Ampicillin - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssf | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Methicillin - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Cephalexin - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssh | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Ceftriaxone - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssi | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Cefditoren - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9yfc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of A30P Alpha-synuclein Fibrils | | Authors: | Milchberg, M.H., Warmuth, O.A., Rienstra, C.M. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9yfa | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the C-terminal DNA-binding domain of BqsR from Pseudomonas aeruginosa | | Authors: | Paredes, A., Singh, H., Smith, A.T. | | Deposition date: | 2025-09-25 |
|