Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9su4
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-633
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9su5
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-695
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9su6
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-705
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9su7
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-728
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
PDBID:9su8
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-743
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9su9
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-753
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9sua
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-758
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9sub
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-768
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
PDBID:9suc
Status:HOLD -- hold until a certain date
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0797
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9sud
Status:AUTH -- processed, waiting for author review and approval
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0801
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9sue
Status:HOLD -- hold until a certain date
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0802
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9suf
Status:HOLD -- hold until a certain date
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0807
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9sug
Status:HOLD -- hold until a certain date
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0822
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9suh
Status:HOLD -- hold until a certain date
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound x0830
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9ssm
Status:HPUB -- hold until publication
Title:Crystal structure of 084-7D Fab bound to SARS-CoV-2 Beta RBD
Authors:Ayres, F., Moyo-Gwete, T., Wibmer, C.K.
Deposition date:2025-09-26
PDBID:9ss7
Status:HPUB -- hold until publication
Title:Human angiotensin 1-converting enzyme C-domain in complex with rentiapril
Authors:Gregory, K.S., Acharya, K.R.
Deposition date:2025-09-25
Sequence:

>Entity 1


EAEASKFVEEYDRTSQVVWNEYAGANWNYNTNITTETSKILLQKNMQIAQHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPQGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWQKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPQMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPN
PDBID:9ssa
Status:HPUB -- hold until publication
Title:Human angiotensin 1-converting enzyme C-domain in complex with zofenoprilat
Authors:Gregory, K.S., Acharya, K.R.
Deposition date:2025-09-25
PDBID:9ssd
Status:HPUB -- hold until publication
Title:PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Penicillin G - Streptococcus pneumoniae R6
Authors:Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A.
Deposition date:2025-09-25
PDBID:9sse
Status:HPUB -- hold until publication
Title:PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Ampicillin - Streptococcus pneumoniae R6
Authors:Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A.
Deposition date:2025-09-25
PDBID:9ssf
Status:HPUB -- hold until publication
Title:PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Methicillin - Streptococcus pneumoniae R6
Authors:Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A.
Deposition date:2025-09-25
PDBID:9ssg
Status:AUTH -- processed, waiting for author review and approval
Title:PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Cephalexin - Streptococcus pneumoniae R6
Authors:Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A.
Deposition date:2025-09-25
PDBID:9ssh
Status:HPUB -- hold until publication
Title:PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Ceftriaxone - Streptococcus pneumoniae R6
Authors:Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A.
Deposition date:2025-09-25
PDBID:9ssi
Status:HPUB -- hold until publication
Title:PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Cefditoren - Streptococcus pneumoniae R6
Authors:Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A.
Deposition date:2025-09-25
PDBID:9yfc
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of A30P Alpha-synuclein Fibrils
Authors:Milchberg, M.H., Warmuth, O.A., Rienstra, C.M.
Deposition date:2025-09-25
PDBID:9yfa
Status:HPUB -- hold until publication
Title:Solution NMR structure of the C-terminal DNA-binding domain of BqsR from Pseudomonas aeruginosa
Authors:Paredes, A., Singh, H., Smith, A.T.
Deposition date:2025-09-25

245663

数据于2025-12-03公开中

PDB statisticsPDBj update infoContact PDBjnumon