PDBID: | 8y9q | Status: | HPUB -- hold until publication | Title: | b-glucosidase from Thermotoga profunda Tp-BGL | Authors: | Guo, Y., Chen, A. | Deposition date: | 2024-02-07 |
|
PDBID: | 8vxv | Status: | AUTH -- processed, waiting for author review and approval | Title: | HIV-1 R18L CA hexamer | Authors: | Schirra, R.T., Pornillos, O., Ganser-Pornillos, B.K. | Deposition date: | 2024-02-06 |
|
PDBID: | 8vxw | Status: | AUTH -- processed, waiting for author review and approval | Title: | HIV-1 R18L CA pentamer from capsid-like particles assembled in 1 M NaCl | Authors: | Schirra, R.T., Pornillos, O., Ganser-Pornillos, B.K. | Deposition date: | 2024-02-06 |
|
PDBID: | 8vxb | Status: | HOLD -- hold until a certain date | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | Authors: | Nalam, P., Cook, P., Smith, B. | Deposition date: | 2024-02-04 | Release date: | 2025-02-04 | Sequence: | >Entity 1 MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
PDBID: | 8vxg | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | The crystal structure of CYP125MRCA, an ancestrally reconstructed CYP125 enzyme | Authors: | Doherty, D.Z., Bruning, J.B., Bell, S.G. | Deposition date: | 2024-02-04 |
|
PDBID: | 8y7n | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Nur77 LBD in complex with N-(2''-(methyl(pentyl)amino)-[4,4''-bipyridin]-2-yl)cinnamamide | Authors: | Hong, W.B., Lin, T.W. | Deposition date: | 2024-02-04 |
|
PDBID: | 8y7l | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Nur77 LBD in complex with N-(2''-(4-hydroxypiperidin-1-yl)-[4,4''-bipyridin]-2-yl)cinnamamide | Authors: | Hong, W.B., Lin, T.W. | Deposition date: | 2024-02-04 |
|
PDBID: | 8vx7 | Status: | HPUB -- hold until publication | Title: | Computationally designed tunable C2 symmetric tandem repeat homodimer, bound to cyclic peptide | Authors: | Kennedy, M.A., Stoddard, B.L., Said, M. | Deposition date: | 2024-02-03 |
|
PDBID: | 8vwi | Status: | HOLD -- hold until a certain date | Title: | The base complex of the AcMNPV baculovirus nucleocapsid (Class 1, localised reconstruction) | Authors: | Johnstone, B.A., Koszalka, P., Ha, J., Venugopal, H., Coulibaly, F. | Deposition date: | 2024-02-01 |
|
PDBID: | 8y64 | Status: | HPUB -- hold until publication | Title: | Crystal structure of open state ferulic acid decarboxylase from Saccharomyces cerevisiae, F397V/I398L/T438P/P441V mutant | Authors: | Feng, Y.B., Song, X., Zhu, X.N. | Deposition date: | 2024-02-01 |
|
PDBID: | 8rvf | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HUMAN MONOGLYCERIDE LIPASE IN COMPLEX WITH COMPOUND 5 | Authors: | Leibrock, L., Hentsch, A., Nazare, M., Grether, U., Kuhn, B., Blaising, J., Benz, J. | Deposition date: | 2024-02-01 |
|
PDBID: | 8vwh | Status: | HPUB -- hold until publication | Title: | Structure of the baculovirus major nucleocapsid protein VP39 (localised reconstruction) | Authors: | Johnstone, B.A., Hardy, J.M., Ha, J.H., Venugopal, H., Coulibaly, F. | Deposition date: | 2024-02-01 |
|
PDBID: | 8vwj | Status: | HPUB -- hold until publication | Title: | The base complex of the AcMNPV baculovirus nucleocapsid (Class 2, localised reconstruction) | Authors: | Johnstone, B.A., Koszalka, P., Ha, J., Venugopal, H., Coulibaly, F. | Deposition date: | 2024-02-01 |
|
PDBID: | 8vwg | Status: | HPUB -- hold until publication | Title: | Structure of the Drosophila retrotransposon Copia capsid | Authors: | Liu, Y., Kelch, B.A. | Deposition date: | 2024-02-01 |
|
PDBID: | 8y5m | Status: | HPUB -- hold until publication | Title: | E.coli transcription translation coupling complex in TTC-B state 2 containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | Deposition date: | 2024-01-31 |
|
PDBID: | 8y5p | Status: | HPUB -- hold until publication | Title: | E.coli transcription translation coupling complex in TTC-B state 4 (subclass 1) containing mRNA with 24-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | Deposition date: | 2024-01-31 |
|
PDBID: | 8y5q | Status: | HPUB -- hold until publication | Title: | E.coli transcription translation coupling complex in TTC-B state 4 (subclass 2) containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and GDPCP | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | Deposition date: | 2024-01-31 |
|
PDBID: | 8y5r | Status: | HPUB -- hold until publication | Title: | E.coli Transcription translation coupling complex in TTC-B state 5 (subclass 1) containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and fusidic acid | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | Deposition date: | 2024-01-31 |
|
PDBID: | 8y5s | Status: | AUTH -- processed, waiting for author review and approval | Title: | E.coli Transcription translation coupling complex in TTC-B state 5 (subclass 2) containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and GDPCP | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | Deposition date: | 2024-01-31 |
|
PDBID: | 8y5t | Status: | HPUB -- hold until publication | Title: | E.coli Transcription translation coupling complex in TTC-B state 5 (subclass 3) containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and fusidic acid | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | Deposition date: | 2024-01-31 |
|
PDBID: | 8y5o | Status: | HPUB -- hold until publication | Title: | E.coli transcription translation coupling complex in TTC-B state 3 (subclass1) containing mRNA with 30-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | Deposition date: | 2024-01-31 |
|
PDBID: | 8y55 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of NAMPT-PF403 | Authors: | Yu, S.S., Liu, Y.B., Li, Y. | Deposition date: | 2024-01-31 |
|
PDBID: | 8vvw | Status: | HPUB -- hold until publication | Title: | Structure of the five-fold capsomer of the Drosophila retrotransposon Copia capsid | Authors: | Liu, Y., Kelch, B.A. | Deposition date: | 2024-01-31 |
|
PDBID: | 8vvz | Status: | HPUB -- hold until publication | Title: | Structure of the three-fold capsomer of the Drosophila retrotransposon Copia capsid | Authors: | Liu, Y., Kelch, B.A. | Deposition date: | 2024-01-31 |
|
PDBID: | 8vw3 | Status: | HPUB -- hold until publication | Title: | Structure of the non-symmetric capsomer of the Drosophila retrotransposon Copia capsid | Authors: | Liu, Y., Kelch, B.A. | Deposition date: | 2024-01-31 |
|