| PDBID: | 9vf9 | | Status: | HPUB -- hold until publication | | Title: | GSTM1 in complex with bithionol | | Authors: | Sun, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vep | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Klebsiella pneumoniae SuhB | | Authors: | Jena, A.K., Yadav, V.K., Bhattacharyya, S. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vew | | Status: | HPUB -- hold until publication | | Title: | SIRT2 structure in complex with H3K18myr peptide and native NAD: pre-catalysis state 2 | | Authors: | Zhang, N., Hao, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vex | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CpaO in complex with beta-CPA | | Authors: | Chang, C.Y., Cheng, T., Kuo, Y.M., Hsiao, P.Y., Wang, M., Wang, N. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfa | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhz | | Status: | HPUB -- hold until publication | | Title: | Structure of a complex of biosynthetic proteins bE5 and CheytinYY | | Authors: | Li de la Sierra-Gallay, I., Gomes, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhv | | Status: | HPUB -- hold until publication | | Title: | GH10 family xylanase XynA from Bacillus sp. KW1 complex with xylobiosyl-configured cyclophellitol probe bearing an alpha-1,3 - Araf decoration | | Authors: | Correa, T.L.R., Li, Z., Moroz, O.V., Pickles, I.B., Akkad, S., Willems, L., Overkleeft, H.S., Davies, G.J. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9ri2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bacillithiol methyltransferase NmbA from Chlorobaculum tepidum | | Authors: | Hammerstad, M., Hersleth, H.-P. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
MSDHQSHSRGKNAREWFEEWFDHPLYLKVYHHRDAEEAERCVRTILDLTGIDPAWQPPHSVLDIACGAGRHALSFARTGLRVTANDLSPYLLDQARKQAKAEGINMEFSRQDMRTIRFERRFDLIAQLFSSFGYFETDQEDRDVIANIASLLNPGGWYVLDLINPVQLKSQFTPRTERNSESLSIIEERTLSERHVTKKITLHEANGRKHSFTESVRIYSPAEAFSLLESGGFAVERVVGDYEGSPFDEATSPRMMLLARLLVSRS
|
|
| PDBID: | 9rhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhr | | Status: | HPUB -- hold until publication | | Title: | FusA (ferredoxin receptor from Pectobacterium atrosepticum) in the presence of Ra-LPS | | Authors: | Machin, J.M., Ranson, N.A. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1a | | Status: | HPUB -- hold until publication | | Title: | B. pseudomallei rubrerythrin room temperature structure from LEAP-X device | | Authors: | Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p11 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p0y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon N | | Authors: | Ribeiro, F.S., Lima, L.M.T.R. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p0z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon N (Duplicate) | | Authors: | Ribeiro, F.S., Lima, L.M.T.R. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p10 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon N (Triplicate) | | Authors: | Lima, L.M.T.R., de Sa Ribeiro, F. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p19 | | Status: | HPUB -- hold until publication | | Title: | B. pseudomallei rubrerythrin room temperature structure | | Authors: | Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Sindhis virus post-fusion E1 structure | | Authors: | Shi, K., Zhang, W. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1b | | Status: | HPUB -- hold until publication | | Title: | P. putida mandelate racemase co-crystallized with tavaborole | | Authors: | Jabin, A., Hayden, J.A., Bearne, S.L., St.Maurice, M. | | Deposition date: | 2025-06-09 | | Sequence: | >Entity 1
MASWSHPQFEKGALEVLFQGPGYHMSEVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
|
|
| PDBID: | 9p1d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9vek | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-09 |
|
