PDBID: | 9umr | Status: | HPUB -- hold until publication | Title: | Structure of C5a-pep bound human C5aR1 in complex with Go | Authors: | Banerjee, R., Yadav, M.K., Ganguly, M., Mishra, S., Dalal, A., Shukla, A.K. | Deposition date: | 2025-04-22 |
|
PDBID: | 9obo | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9obi | Status: | HPUB -- hold until publication | Title: | Room Temperature X-Ray Structure of HIV-1 Protease in Complex with Inhibitor GRL-075-24A | Authors: | Bhandari, D., Kovalevsky, A., Ghosh, A.K. | Deposition date: | 2025-04-22 | Sequence: | >Entity 1 PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
PDBID: | 9obd | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9obe | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9obh | Status: | HPUB -- hold until publication | Title: | Co-Structure of SARS-CoV-2 with Compound 34 | Authors: | Knapp, M.S., Ornelas, E. | Deposition date: | 2025-04-22 |
|
PDBID: | 9obb | Status: | HPUB -- hold until publication | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania brasiliensis in complex with 5-[(E)-3-(p-methoxyphenyl)-2-propenylidene]-2,4,6(1H,3H,5H)-pyrimidinetrione | Authors: | Vaidergorn, M.M., Nonato, M.C., Froes, T.Q., Augusto, B.S. | Deposition date: | 2025-04-22 |
|
PDBID: | 9obm | Status: | HPUB -- hold until publication | Title: | Solution structure or pre-miR-20a | Authors: | Keane, S.C. | Deposition date: | 2025-04-22 |
|
PDBID: | 9obk | Status: | HPUB -- hold until publication | Title: | A-beta42-Met-R-SO amyloidal fibril | Authors: | Chan, K.L., Boyer, D., Balasco Serrao, V.H., Raskatov, J.A. | Deposition date: | 2025-04-22 |
|
PDBID: | 9obj | Status: | HPUB -- hold until publication | Title: | Room temperature structure of carbonic anhydrase II in complex with vorinostat (drug soak) | Authors: | Gulkis, M.C., McKenna, R., Fisher, S.Z. | Deposition date: | 2025-04-22 |
|
PDBID: | 9obl | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of anti-HCV human broadly neutralizing antibody K579 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2025-04-22 |
|
PDBID: | 9obn | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9obf | Status: | HPUB -- hold until publication | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 peptide GLAPPQHLIRV | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | Deposition date: | 2025-04-22 |
|
PDBID: | 9obg | Status: | HPUB -- hold until publication | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 mutant peptide GLAPPQHLFRV | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | Deposition date: | 2025-04-22 |
|
PDBID: | 9qzb | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | E6P5 Fab in complex with the major capsid protein VP1 of BK polyomavirus, genotype I | Authors: | Pedenko, B., Schoehn, G., Effantin, G., Poignard, P. | Deposition date: | 2025-04-22 |
|
PDBID: | 9qz9 | Status: | HPUB -- hold until publication | Title: | mycobacterial cytochrome bc1:aa3 with inhibitor | Authors: | Lamers, M.H., Verma, A.K., Noteborn, W.E.M. | Deposition date: | 2025-04-22 |
|
PDBID: | 9qzd | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9qzc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-04-22 |
|
PDBID: | 9qzf | Status: | AUCO -- author corrections pending review | Deposition date: | 2025-04-22 |
|
PDBID: | 9qz4 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9qz5 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9qz6 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9qz7 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9qz8 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-22 |
|
PDBID: | 9qze | Status: | HOLD -- hold until a certain date | Title: | Exploiting ALDH1A2 and ALDH1A3 Isoform Variability for Crystallization Screening | Authors: | Garaavglia, S., Mazzorana, M. | Deposition date: | 2025-04-22 | Release date: | 2026-04-22 |
|