| PDBID: | 9rik | | Status: | HPUB -- hold until publication | | Title: | EV-A71 (genotype B5) in complex with 16-2-2D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ril | | Status: | HPUB -- hold until publication | | Title: | EV-A71 (genotype B5) in complex with 16-3-3C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9rim | | Status: | HPUB -- hold until publication | | Title: | EV-A71 (genotype B5) in complex with 16-3-4D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9rin | | Status: | HPUB -- hold until publication | | Title: | EV-A71 (genotype B5) in complex with 17-1-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9rio | | Status: | HPUB -- hold until publication | | Title: | EV-A71 (genotype B5) in complex with 17-2-2B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9rip | | Status: | HPUB -- hold until publication | | Title: | EV-A71 (genotype B5) in complex with 17-2-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9riq | | Status: | HPUB -- hold until publication | | Title: | EV-A71 (genotype C4) in complex with 16-2-11B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9rir | | Status: | HPUB -- hold until publication | | Title: | EV-A71 (genotype C4) in complex with 16-3-10B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9riw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9riu | | Status: | HPUB -- hold until publication | | Title: | Co-crystal of broadly neutralizing VHH in complex with short neurotoxin 1 (P01426) Naja pallida | | Authors: | Burlet, N.J., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9riv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9rit | | Status: | HPUB -- hold until publication | | Title: | Co-crystal of broadly neutralizing biparatopic VHH in complex with cardiotoxin (P01468) Naja pallida | | Authors: | Burlet, N.J., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ri6 | | Status: | HPUB -- hold until publication | | Title: | Zn finger-finger DNA complex | | Authors: | Yao, Y.M., OHagan, M.P., Onoon, K., Givon, L., Rogotner, S., Kessler, N., Dym, O., Pipatpolkai, T., Schumacher, M.A., Afek, A. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ric | | Status: | HPUB -- hold until publication | | Title: | Zn finger-finger DNA complex | | Authors: | Yao, Y.M., OHagan, M.P., Onoon, K., Givon, L., Rogotner, S., Kessler, N., Dym, O., Pipatpolkai, T., Schumacher, M.A., Afek, A. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9rie | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ris | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9rif | | Status: | HPUB -- hold until publication | | Title: | The histone fold domain heterodimer of oocyst rupture proteins 1 and 2 from Plasmodium berghei | | Authors: | Gourlay, L.J., Nardini, M. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9ri7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ube2E3 | | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
| PDBID: | 9p1k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of sensory domain of CdgA from Vibrio cholerae O1 biovar El Tor str. N16961 | | Authors: | Marceau, A.H., Mariscal, V.T., Tripathi, S.M., Yildiz, F.H., Rubin, S.M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1h | | Status: | HPUB -- hold until publication | | Title: | 100K human S-adenosylmethionine decarboxylase | | Authors: | Patel, J.R., Bonzon, T.J., Bahkt, T., Fagbohun, O.O., Clinger, J.A. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
(PYR)SMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS
>Entity 2
MHHHHHHENLYFQGEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
|
|
| PDBID: | 9p1v | | Status: | HPUB -- hold until publication | | Title: | Structural of MAb PhtD3 in complex with PhtD | | Authors: | Du, J., Cui, J., Lin, Z., Eisenhauer, J., Pallesen, J., Weiner, D.B. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TCZ9 from Streptomyces | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1j | | Status: | HPUB -- hold until publication | | Title: | Staphylococcus aureus ClpP in complex with chimerabactin | | Authors: | Lee, R.E., Griffith, E.C. | | Deposition date: | 2025-06-10 |
|
