| PDBID: | 9nvw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of rhesus antibody CH35-Apex1.08 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody CH70-Apex1.01 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody CH42-Apex1.01 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody CH42-Apex2.01 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qm6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of highly stable methionine gamma-lyase from Thermobrachium celere in complex with PLP and norleucine | | Authors: | Kopecny, D., Ferchaud, N., Briozzo, P. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | NMR2 Structure of KRAS G12V (GDP bound) in complex with 2-((1H-indol-3-yl)methyl)-1H-benzo[d]imidazol-5-amine | | Authors: | Buetikofer, M., Orts, J. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlr | | Status: | HPUB -- hold until publication | | Title: | Nonamer crystal structure of the transcription factor MraZ from Mycoplasma genitalium | | Authors: | Reverter, D., Sanchez-Alba, L. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qld | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-nitrophenol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9qky | | Status: | HPUB -- hold until publication | | Title: | The structure of the DNA-binding domain of Nuclear Factor 1 X bound to NFI consensus DNA sequence | | Authors: | Tiberi, M., Nardini, M., Chaves-Sanjuan, A., Gourlay, L.J., Bonnet, D.M.V. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human CRP-CPS23F complex | | Authors: | Chen, D.Y., Xie, Y.F., Gao, F., Qi, J.X., Zhang, J.R. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nug | | Status: | PROC -- to be processed | | Title: | D-Ornithine/D-lysine decarboxylase C387A complexed with putrescine, D-arginine and agmatine | | Authors: | Phillips, R.S., Blankenship, S. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nu6 | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 main protease with inhibitor | | Authors: | Dougan, D.R. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk7 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 1 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk8 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 2 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk9 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 3 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qka | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 4 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkc | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 6 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkd | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 7 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qke | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 8 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkf | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 9 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkh | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 11 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qki | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 12 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkj | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 13 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkk | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 14 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkg | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 10 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
