Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9frm
Status:HPUB -- hold until publication
Title:The crystal structure of glycogen phosphorylase with an indole derivative
Authors:Koulas, S.M., Leonidas, D.D.
Deposition date:2024-06-19
Sequence:

>Entity 1


MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKI(CSO)GGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVK(CSO)QERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKIP
PDBID:9frl
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to SD mRNA with h44 in up position
Authors:Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E.
Deposition date:2024-06-19
PDBID:9fra
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-MAP leaderless mRNA
Authors:Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E.
Deposition date:2024-06-18
PDBID:9frc
Status:AUTH -- processed, waiting for author review and approval
Title:Architectural insights into spatially distinct corrin and metal binding sites of CobN
Authors:Pickersgill, R.W., Brown, D.G., Ladakis, D., Warren, M.J.
Deposition date:2024-06-18
PDBID:9frd
Status:HPUB -- hold until publication
Title:Wildtype EGFR bound with Compound 23
Authors:Pagliarini, A.R., Milgram, B.C., Borrelli, D.R., OHearn, E., Huff, M.R., Ladd, B., Brooijmans, N., Henderson, J.A., Hilbert, B.J., Wang, W., Ito, T.
Deposition date:2024-06-18
PDBID:8zyy
Status:HPUB -- hold until publication
Title:Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553 (complex 3)
Authors:Sun, D., Li, X., Yuan, Q., Yin, W., Xu, H.E., Tian, C.
Deposition date:2024-06-18
PDBID:9cb6
Status:HPUB -- hold until publication
Title:Crystal Structure of RT-PhyR (ruthe_02744)
Authors:Swingle, D., Isiorho, E.A., Gardner, K.H.
Deposition date:2024-06-18
Sequence:

>Entity 1


GEFMPQTFADAVAASLPHLRRYARALTGEQRTGDAIAARTLEGLIADPSVLERDLEPRLMLFRAFHRTWRREGAPVGEADSHLAQRAQSHLARLTPNTREALLLHAIEGFTAQEIGAVMEVPPETAADFIDTALREMAESVAGRVMIIEDEAIIAMDIAAIVREMGHRVTGIARTRFEAVRLAREERPDLILADIQLADNSSGIDAVNEILAEFADLPVIFITAFPERLLTGERPEPAFLITKPYREEQVRSAVSQAMFFASTETLAA
PDBID:9fqt
Status:HPUB -- hold until publication
Title:Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the apo inward-open state
Authors:Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B.
Deposition date:2024-06-17
PDBID:9fqu
Status:HPUB -- hold until publication
Title:Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the arginine-bound inward-occluded state
Authors:Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B.
Deposition date:2024-06-17
PDBID:9fqv
Status:HPUB -- hold until publication
Title:Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the lysine-bound inward-occluded state
Authors:Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B.
Deposition date:2024-06-17
PDBID:9fqw
Status:HPUB -- hold until publication
Title:Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the ornithine-bound inward-occluded state
Authors:Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B.
Deposition date:2024-06-17
PDBID:8zyi
Status:HPUB -- hold until publication
Title:crystal structure of GH57 family amylopullulanase mutant D352N from Aquifex aeolicus in complex wih 6-alpha-D-maltotriosyl-maltotriose
Authors:Zhu, Z.M., Wang, W.W., Yu, F.
Deposition date:2024-06-17
PDBID:9ca6
Status:HPUB -- hold until publication
Title:Rns Pocket Mutant - I14F/I17F
Authors:Tolbert, J.D., Midgett, C.R., Kull, F.J.
Deposition date:2024-06-17
PDBID:9c9j
Status:HPUB -- hold until publication
Title:Atomic structure of Vibrio cholerae VopM/F-actin complex by cryo-EM
Authors:Niedzialkowska, E., Dong, S., Kudryashova, E., Kudryashov, D., Egelman, E.H.
Deposition date:2024-06-14
PDBID:9c9n
Status:HPUB -- hold until publication
Title:Crystal structure of Fe/2-OG dependent dioxygenase MysH in complex with nickel and succinate
Authors:Wanniarachchi, T.N., Bruner, S.D.
Deposition date:2024-06-14
PDBID:9fp4
Status:AUTH -- processed, waiting for author review and approval
Title:FGD2 (Rv0132c) from Mycobacterium tuberculosis crystallised with Anderson-Evans polyoxotungstate
Authors:Aderemi, A., Snee, M., Levy, C., Leys, D.
Deposition date:2024-06-13
PDBID:9fpp
Status:HPUB -- hold until publication
Title:FGD2 (Rv0132c) from Mycobacterium tuberculosis with cofactor F420 crystallised with Anderson-Evans polyoxotungstate
Authors:Aderemi, A., Snee, M., Levy, C., Leys, D.
Deposition date:2024-06-13
PDBID:9c8i
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of EV-D68 B3 Inactivated Virus Particle
Authors:Cheng, J., Krug, P.W., Lei, H., Moss, D.L., Huang, R., Lang, Z.C., Morton, A.J., Shen, C., Pierson, T.C., Zhou, T., Ruckwardt, T.J., Kwong, P.D.
Deposition date:2024-06-12
PDBID:9c8f
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of EV-D68 B3 A-Particle
Authors:Cheng, J., Krug, P.W., Lei, H., Moss, D.L., Huang, R., Lang, Z.C., Morton, A.J., Shen, C., Pierson, T.C., Zhou, T., Ruckwardt, T.J., Kwong, P.D.
Deposition date:2024-06-12
PDBID:9c8g
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of EV-D68 A2 Inactivated Virus Particle
Authors:Cheng, J., Krug, P.W., Lei, H., Moss, D.L., Huang, R., Lang, Z.C., Morton, A.J., Shen, C., Pierson, T.C., Zhou, T., Ruckwardt, T.J., Kwong, P.D.
Deposition date:2024-06-12
PDBID:9c8h
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of EV-D68 A2 A-Particle
Authors:Cheng, J., Krug, P.W., Lei, H., Moss, D.L., Huang, R., Lang, Z.C., Morton, A.J., Shen, C., Pierson, T.C., Zhou, T., Ruckwardt, T.J., Kwong, P.D.
Deposition date:2024-06-12
PDBID:9c7x
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 antibody 1H06 in complex with a HR2 peptide
Authors:Van Wazer, D.J., Zhou, T., Kwong, P.D.
Deposition date:2024-06-11
PDBID:9c7z
Status:AUTH -- processed, waiting for author review and approval
Title:Hallucinated C3 protein assembly HALC3_919
Authors:Ragotte, R., Bera, A., Milles, L.F., Wicky, B.I.M., Baker, D.
Deposition date:2024-06-11
PDBID:8zuw
Status:HPUB -- hold until publication
Title:Crystal structure of Bacteroides thetaiotaomicron glutamate decarboxylase
Authors:Liu, S., Yulu, W., Guoming, D., Boting, W., Xin, F.
Deposition date:2024-06-10
PDBID:9c77
Status:HPUB -- hold until publication
Title:cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in cA4 bound form with ATP.
Authors:Majumder, P., Patel, D.J.
Deposition date:2024-06-10

226262

数据于2024-10-16公开中

PDB statisticsPDBj update infoContact PDBjnumon