| PDBID: | 9sc4 | | Status: | HPUB -- hold until publication | | Title: | Structure of Yeast RNA polymerase II elongation complex with ATP frame-20 | | Authors: | Yi, G., Li, Q., Zhang, P., Wang, D. | | Deposition date: | 2025-08-08 |
|
| PDBID: | 9sbz | | Status: | HPUB -- hold until publication | | Title: | Structure of Yeast RNA polymerase II elongation complex with ATP frame-15 | | Authors: | Yi, G., Li, Q., Zhang, P., Wang, D. | | Deposition date: | 2025-08-08 |
|
| PDBID: | 9sc3 | | Status: | HPUB -- hold until publication | | Title: | Structure of Yeast RNA polymerase II elongation complex with ATP frame-19 | | Authors: | Yi, G., Li, Q., Zhang, P., Wang, D. | | Deposition date: | 2025-08-08 |
|
| PDBID: | 9w7v | | Status: | HPUB -- hold until publication | | Title: | SuperFi Cas9 - 20nt sgRNA - DNA ternary complex Class D | | Authors: | Zheng, R., Ma, L.J. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9saj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP14 in complex with compound 5 | | Authors: | Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsworth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9sas | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Chlorophyll synthase in complex with the LHC-like protein HliD, apo state | | Authors: | Shvarev, D., Hitchcock, A., Sobotka, R. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9sak | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP14 in complex with compound 6 | | Authors: | Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsworth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9sal | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP14 in complex with compound 18 | | Authors: | Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsworth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9sam | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP14 in complex with compound 26 | | Authors: | Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsworth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9san | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP14 in complex with compound 27 | | Authors: | Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsworth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9sau | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Chlorophyll synthase in complex with the LHC-like protein HliD, GGPP-bound state | | Authors: | Shvarev, D., Hitchcock, A., Sobotka, R. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9sa7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Methanocaldococcus jannaschii Malate dehydrogenase C7 mutant | | Authors: | Coquille, S., Madern, D. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9s9g | | Status: | HPUB -- hold until publication | | Title: | S. islandicus CdvA filament (X-ray) | | Authors: | Salzer, R., Lowe, J., Bellini, D. | | Deposition date: | 2025-08-06 | | Sequence: | >Entity 1
MPVSYEVLTKFIGQKVKDIYGREFGYLIHVYSEIDGSITGIEVAQGSSILTMGPERIKLDGDSILILPDWKAEAIRILSLMEKIRKRQRALEELYNKQEIPKSDYDDMKRKLDTEMLKVKDDQNKLKGKLKSRLNDIEDQLAHIDKAVISLKMSYISSEIPENAYKGSMEVLRQSKDSYTLERDDIRKTLDRLDSLDKESIELKPLGSLSTSQQGEAKSDQSKSEIPLPIPVKVINTL
|
|
| PDBID: | 9s9i | | Status: | HPUB -- hold until publication | | Title: | S. islandicus CdvA (non-polymerising mutant) | | Authors: | Salzer, R., Lowe, J., Bellini, D. | | Deposition date: | 2025-08-06 | | Sequence: | >Entity 1
MPVSYEVLTKFIGQKVKDIYGREFGYLIHVYSEIDGSITGIEVAQGSSILTMGPERIKLDGDSILILPDWKAEAIRILSLMEKIRKRQRDLEEDYNKQEDPKSDYDDMKRKLDTEMLKVKDDQNKLKGKLKSRLNDIEDQLAHIDKAVDSLKDSYDSSEIPENAYKGSMEVLRQSKDSYTLERDDIRKTLDRLDSLDKESIELKPLGSLSTSQQGEAKSDQSKSEIPLPIPVKVINTL
|
|
| PDBID: | 7ik9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1198177230 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ika | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1203730757 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ikb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1255459547 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ikc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1262549981 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ikd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1262628644 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ike | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1265813904 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ikf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1269220427 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ikg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1272480091 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ikh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1273312142 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7iki | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z1331830630 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 7ikj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with Z133716556 | | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | | Deposition date: | 2025-08-06 |
|
