| PDBID: | 9ga6 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human Annexin A4 derived from crystals grown in 40 mM of CaCl2 | | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Bifulco, G., Campiglia, P., Sala, M., Scala, M.C., Ruggiero, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of human Annexin A4 derived from crystal grown at 4 mM CaCl2 and retro-soaking | | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Scala, M.C., Sala, M., Campiglia, P., Bifulco, G., Ruggiero, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga8 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human Annexin A4 from crystals grown at 4 mM Calcium | | Authors: | Ruggiero, A., Barra, G., Ghilardi, O., Scala, M.C., Sala, M., Di Micco, S., Bifulco, G., Campiglia, P., Vitagliano, L. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga3 | | Status: | HPUB -- hold until publication | | Title: | MtUvrA2UvrB bound to damaged oligonucleotide | | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga5 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | MtUvrA2 bound to endogenous E. coli DNA | | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix9 | | Status: | HPUB -- hold until publication | | Title: | Mutant H286T Crystal Structure of Two-domain bacterial laccase from the actinobacterium Streptomyces carpinensis VKM Ac-1300 | | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Trubitsina, L., Trubitsin, I., Leontievsky, A., Lisov, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix8 | | Status: | HPUB -- hold until publication | | Title: | Crystallization and structural characterization of phosphopentomutase from the hyperthermophilic archaeon Thermococcus kodakarensis | | Authors: | Naz, Z., Lubkowski, T.J., Saleem, M., Rahman, M., Wlodawer, A., Rashid, N. | | Deposition date: | 2024-07-26 | | Sequence: | >Entity 1
RLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKALVGRDGRTSSVMLKNAMISGLLSTGMEVLDADLIPTPALAWGTRKLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEAEKK
|
|
| PDBID: | 9cux | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SETDB1 Tudor domain in complex with UNC100016 | | Authors: | Silva, M., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9cuw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SETDB1 Tudor domain in complex with UNC100013 | | Authors: | Silva, M., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9g9u | | Status: | HOLD -- hold until a certain date | | Title: | The structure of XynX, a NIF3 family protein from Geobacillus proteiniphilus T-6 | | Authors: | Hadad, N., Pomyalov, S., Lavid, N., Shoham, Y., Shoham, G. | | Deposition date: | 2024-07-25 | | Release date: | 2025-07-25 |
|
| PDBID: | 9iwd | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | High Resolution Crystal Structure of Glyceraldehyde-3-Phosphate Dehydrogenase from Saccharomyces cerevisiae Complexed with a Maleate Derivative | | Authors: | Cao, H., Zhang, X., Ren, Y., Wan, J. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwb | | Status: | HPUB -- hold until publication | | Title: | High Resolution Crystal Structure of Glyceraldehyde-3-Phosphate Dehydrogenase from Saccharomyces cerevisiae Complexed with a Maleate Derivative | | Authors: | Cao, H., Zhang, X., Ren, Y., Wan, J. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwc | | Status: | HPUB -- hold until publication | | Title: | High Resolution Crystal Structure of Glyceraldehyde-3-Phosphate Dehydrogenase from Saccharomyces cerevisiae Complexed with a Maleate Derivative | | Authors: | Cao, H., Zhang, X., Ren, Y., Wan, J. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwg | | Status: | HPUB -- hold until publication | | Title: | crystal structure of xanthine-II ML2/3 in complex with xanthine | | Authors: | Xu, X.C., Ren, A.M. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu7 | | Status: | HPUB -- hold until publication | | Title: | Structure of 16.ND.92 Fab in complex with A/Solomon Islands/3/2006(H1N1) influenza virus Hemagglutinin | | Authors: | Ouyang, W.O., Pholcharee, T., Wu, N.C. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 M (long conformation) in the presence of C1P | | Authors: | Dolan, K.A., Brohawn, S.G. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu6 | | Status: | HPUB -- hold until publication | | Title: | LJF-034 Fab in complex with HIV Env JRFL NFL TD CC3+ trimer and 35O22 Fab | | Authors: | Ozorowski, G., Ward, A.B. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LJF-085 Fab in complex with HIV Env JRFL NFL TD CC3+ trimer and 35O22 Fab | | Authors: | Ozorowski, G., Ward, A.B. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9g8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the persulfide dioxygenase (PDO - PA2915) from Pseudomonas aeruginosa | | Authors: | Troilo, F., Giordano, F., Giuffre, A., Giardina, G., Di Matteo, A. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MLKPDITAFFDPATSTYSYVVRDPSSRACAIVDPVLDYDPAAGRTSHASAERLIAHVRQHDLQVEWLLETHVHADHLSAAIFLQRELGGCLAIGARITQVQAKFSGLFNLGEAFPVDGRQFEHLFEDGESFRIGALECRALHTPGHTPACMTYLVGDSAFVGDTLFMPDYGTARCDFPGGDARQLYRSIQRLFALPDATRLFMCHDYTAPGRDEHRCETSVGEQRRHNVHVREGVDEEAFVAMRQQRDATLGMPTLMLPAIQVNMRGGNLPPVEGNGVRYLKIPLDLFLEHHHHHH
|
|
| PDBID: | 9g8u | | Status: | HPUB -- hold until publication | | Title: | Structure of the LipA:LipB complex from Acinetobacter baumannii | | Authors: | de Oliveira Silva, Y.R., Contreras-Martel, C., Rodrigues de Melo, R., Zanphorlin, L., Trindade, D.M., Dessen, A. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g93 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoET structure of the in vitro grown Bacillus anthracis Sap S-layer | | Authors: | Sogues, A., Leigh, K., Van der Verren, S., Kudryashev, M., Pak, A., Halingstad, E.V., Cecil, A.J., Fioravanti, A., Remaut, H. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csz | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of M271 a new Kunitz-STI from potato | | Authors: | Campuzano-Gonzalez, A., Rudino-Pinera, E. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ct1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex between the porcine trypsin and M271 a Kunitz-STI from Solanum tuberosum | | Authors: | Campuzano-Gonzalez, A., Rudino-Pinera, E. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csx | | Status: | HPUB -- hold until publication | | Title: | matrix metalloproteinase-10 proenzyme | | Authors: | Isiorho, E.A. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human glyoxalase domain-containing protein 4 (GLOD4) at 2.33 A resolution. | | Authors: | Griswold-Prenner, I., Dou, Y., Jennings, A., Kayser, F. | | Deposition date: | 2024-07-24 |
|
