| PDBID: | 9ues | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uex | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-09 | | Release date: | 2026-04-09 |
|
| PDBID: | 9uf5 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 8 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uer | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uep | | Status: | HPUB -- hold until publication | | Title: | The structure of FIPV RBD and cat APN complex | | Authors: | Sun, J.Q. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9ueu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o55 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o5c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR solution structure of recombinantly synthesized tarantula toxin GsAF2 | | Authors: | Adhikary, K., Poget, S.F., Zhuang, J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o54 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o50 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of Thermus thermophilus SHMT in complex with tetrahydrofolate (THF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-09 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTH(LLP)TLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9o4z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o5a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o56 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o58 | | Status: | HPUB -- hold until publication | | Title: | Zymogen ADAM17-iRhom2 complex bound by the MEDI3622 Fab | | Authors: | Slone, C.E., Maciag, J.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o59 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o5b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RNase A in complex with N1-Methylpseudouridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o4x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qtn | | Status: | HPUB -- hold until publication | | Title: | Human alpha7 nicotinic receptor in complex with the F1 nanobody | | Authors: | Barilone, N., Vangelatou, M., Marouf, F.Z., Dejean de la Batie, G., Ayme, G., Lafaye, P., Corringer, P.-J., Prevost, M.S. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qu1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qts | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-09 |
|
