| PDBID: | 9vyw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of UPF0235 protein PF1765 from Pyrococcus furiosus crystallized with CaCl2 at pH 5 | | Authors: | Yadav, B., Gaikwad, S.S., Shubhangi, S., Kumar, A., Chandravanshi, K., Makde, R.D. | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9s1s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of C278S mutant of mouse CDC14A in complex with a model phosphopeptide | | Authors: | Shabbir, K., Jackisch, G., Sele, C., Murina, V., Knecht, W., Wilson, E., Dong, L., Friedman, T.B., Imtiaz, A., Logan, D.T. | | Deposition date: | 2025-07-21 | | Sequence: | >Entity 1
AAESGELIGACEFMKDRLYFATLRNRPKSTINIHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTSFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTVLDCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKNNVTTIVRLNKKIYEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHSKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFLKEKQASLWVQGDIFRSKLKNR
>Entity 2
A(SEP)PRRR
|
|
| PDBID: | 9s1t | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of a de novo designed six-helix barrel | | Authors: | Oberdorfer, G., Elaily, W., Stoll, D., Chakatok, M., Grill, B. | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9vxh | | Status: | HPUB -- hold until publication | | Title: | SFTSV-Gn/N2C1 complex | | Authors: | Wan, F., Shu, B., Wang, X. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9vxe | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of NapIM_type1 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Cui, B.Y., Liu, C. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9pms | | Status: | HPUB -- hold until publication | | Title: | Epitope editing of CD90 protects hematopoietic stem cells from immunotherapy and enables targeted enrichment for gene therapy | | Authors: | Choo, S., Radtke, S., Rupert, P.B., Tong, A.H., Swing, K., Repele, A., Starrs, M., Humphreys, T., Darari, A., Strong, R.K., Keim, H.P. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9pn1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Q108K:K40L:T51V:T53C:R58W:T29L:Y19W:Q4A mutant of cellular retinol binding protein II complex with 15-cis-retinal | | Authors: | Ehyaei, N., Silva, K., Bingham, C., Geiger, J.H., Borhan, B. | | Deposition date: | 2025-07-18 | | Sequence: | >Entity 1
TRDANGTWEMESNENFEGWMKALDIDFALRKIAVRLTQTLVIDQDGDNFKVKCTSTFWNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKKWIEGDKLYLELTCGDQVCRQVFKKK
|
|
| PDBID: | 9pmi | | Status: | HPUB -- hold until publication | | Title: | Structure of a bifunctional ulvan active enzymes | | Authors: | Mihalynuk, L., Boraston, A.B. | | Deposition date: | 2025-07-17 |
|
| PDBID: | 9vvp | | Status: | HPUB -- hold until publication | | Title: | Core proteins of the bacteriophage E1004 | | Authors: | Sun, B.N., Liu, H.R. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vvr | | Status: | HPUB -- hold until publication | | Title: | Structure of the bacteriophage E1004 tail | | Authors: | Sun, B.N., Liu, H.R. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vvq | | Status: | HPUB -- hold until publication | | Title: | Structure of the bacteriophage E1004 capsid | | Authors: | Sun, B.N., Liu, H.R. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vvt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the LysR-type transcriptional regulator CutR from mycobacterium sp. strain JC1 | | Authors: | Cho, H.J., Kang, B.S. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the LysR-type transcriptional regulator CutR from mycobacterium sp. strain JC1 | | Authors: | Cho, H.J., Lee, K.Y., Kang, B.S. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9vwd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human glutaminyl-peptide cyclotransferase with I321A mutation, in complex with (E)-3-(2-methoxyphenyl)-6-((5-(prop-1-en-1-yl)-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one | | Authors: | Li, G.-B., Ning, X.-L. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9pm7 | | Status: | HPUB -- hold until publication | | Title: | Structure of an S1_25 sulfatase | | Authors: | Berry, N., Boraston, A.B. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s0r | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human NHE6 in C1 symmetry | | Authors: | Feilen, L.P., Trachant, E.E., Lalic, M.R., Sach, L., Havelund, J.F., Ostendorf, J., Faergeman, N.J., Pedersen, S.F., Kragelund, B.B., Autzen, H.E. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9pm1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an engineered PETase, EV2, derived from Thermobifida fusca cutinase (TfCut2) | | Authors: | Mathews, I.I., Norton-Baker, B., Storment, O.O., McGeehan, J.E., Beckham, G.T., Gauthier, N.P. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9pm2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an engineered PETase, EV3, derived from Thermobifida fusca cutinase (TfCut2) | | Authors: | Mathews, I.I., Norton-Baker, B., Storment, O.O., McGeehan, J.E., Beckham, G.T., Gauthier, N.P. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9plx | | Status: | HPUB -- hold until publication | | Title: | The structure of O-glycopeptidase BcM60K from Bacteroides caccae in complex with a core 2 glycan | | Authors: | Boraston, A.B., Pluvinage, B. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9plw | | Status: | HPUB -- hold until publication | | Title: | The structure of O-glycopeptidase BcM60K from Bacteroides caccae in complex with a core 2 glycan | | Authors: | Boraston, A.B., Pluvinage, B. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9pm5 | | Status: | HPUB -- hold until publication | | Title: | The structure of O-glycopeptidase BcM60K from Bacteroides caccae in complex with a 6-sialo core 1 glycan | | Authors: | Boraston, A.B., Pluvinage, B. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9pm4 | | Status: | HPUB -- hold until publication | | Title: | The structure of O-glycopeptidase BcM60C from Bacteroides caccae in complex with a 6-sialo core 1 glycan | | Authors: | Boraston, A.B., Pluvinage, B. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9plp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of netrin-1 in complex with anti-netrin-1 Fab (NP137 Fab) | | Authors: | Rafiei, F., Bailey-Elkin, B.A., Stetefeld, J. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9pl7 | | Status: | HPUB -- hold until publication | | Title: | The structure of O-glycopeptidase BcM60K from Bacteroides caccae | | Authors: | Boraston, A.B., Pluvinage, B. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9pl8 | | Status: | HPUB -- hold until publication | | Title: | The structure of O-glycopeptidase BcM60C from Bacteroides caccae | | Authors: | Boraston, A.B., Pluvinage, B. | | Deposition date: | 2025-07-15 |
|
