| PDBID: | 9ogd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human exportin-1 conjugated with KPT-185 and bound to human ASB8(R197A)-ELOB/C | | Authors: | Wing, C.E., Fung, H.Y.J., Chook, Y.M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9r2j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human MAO B in complex with (E)-3-(4-nitrophenyl)-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one (chalcone inhibitor, 4a) | | Authors: | Marchese, S., Binda, C. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9ofa | | Status: | HPUB -- hold until publication | | Title: | The structure of a Fungal Cyanide Hydratase from Gloeocercospora sorghi | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Farah, C.S. | | Deposition date: | 2025-04-29 | | Sequence: | >Entity 1
MPINKYKAAVVTSEPVWENLEGGVVKTIEFINEAGKAGCKLIAFPEVWIPGYPYWMWKVNYLQSLPMLKAYRENSIAMDSSEMRRIRAAARDNQIYVSIGVSEIDHATLYLTQVLISPLGDVINHRRKIKPTHVEKLVYGDGSGDSFEPVTQTEIGRLGQLNCWENMNPFLKSLAVARGEQIHVAAWPVYPDLSKQVHPDPATNYADPASDLVTPAYAIETGTWVLAPFQRISVEGLKRHTPPGVEPETDATPYNGHARIFRPDGSLYAKPAVDFDGLMYVDIDLNESHLTKALADFAGHYMRPDLIRLLVDTRRKELVTEVGGGDNGGIQSYSTMARLGLDRPLEEEDYRQGTDAGETEKASSNGHA
|
|
| PDBID: | 9r2d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of allylic transferase enzyme ASB1.3 | | Authors: | Levy, C.W., Ortmayer, M. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9odt | | Status: | HPUB -- hold until publication | | Title: | The structure of a Bacterial Cyanide Dihydratase from Bacillus safensis PER-URP-08 | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Chuck, C.S. | | Deposition date: | 2025-04-27 | | Sequence: | >Entity 1
MTSIYPKFRAAAVQAAPVYLNLEATVEKSCELIDEAASNGAKLVAFPEAFLPGYPWFAFIGHPEYTRKFYHELYKNAVEIPSLAIQKISEAAKRNETYVCISCSEKDGGSLYLAQLWFNPNGDLIGKHRKMRASVAERLIWGDGSGSMMPVFQTDIGNLGGLMCWEHQVPLDLMAMNAQNEQVHVASWPGYFDDEISSRYYAIATQTFVLMTSSIYTEEMKEMICLTQEQRDYFETFKSGHTCIYGPDGEPISDMVPAETEGIAYAEIDVERVIDYKYYIDPAGHYSNQSLSMNFNQQPTPVVKQLYHQKNEVFTYEDIQYQHGILEEKV
|
|
| PDBID: | 9uov | | Status: | HPUB -- hold until publication | | Title: | PSI-8 FCPI supercomplex from haptophyte Chrysotila roscoffensis | | Authors: | La Rocca, R., Tsai, P.-C., Kato, K., Nakajima, Y., Akita, F., Shen, J.-R. | | Deposition date: | 2025-04-26 |
|
| PDBID: | 9uod | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of pHBMT1 from Populus trichocarpa | | Authors: | Li, Q., Liu, Y.C., Li, T., Han, X.D. | | Deposition date: | 2025-04-25 | | Release date: | 2026-04-25 |
|
| PDBID: | 9uo3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human IgM-Fc hexamer | | Authors: | Ji, C., Zhang, R., Xiao, J. | | Deposition date: | 2025-04-25 |
|
| PDBID: | 9uof | | Status: | HPUB -- hold until publication | | Title: | PSI-6 FCPI supercomplex from haptophyte Chrysotila roscoffensis | | Authors: | La Rocca, R., Tsai, P.-C., Kato, K., Nakajima, Y., Akita, F., Shen, J.-R. | | Deposition date: | 2025-04-25 |
|
| PDBID: | 9unu | | Status: | HPUB -- hold until publication | | Title: | PSI-1 FCPI supercomplex from haptophyte Chrysotila roscoffensis | | Authors: | La Rocca, R., Tsai, P.-C., Kato, K., Nakajima, Y., Akita, F., Shen, J.-R. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9ocm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania brasiliensis in complex with (E)-5-(3-(4-nitrophenyl)allylidene)pyrimidine-2,4,6(1H,3H,5H)-trione | | Authors: | Vaidergorn, M.M., Nonato, M.C., Froes, T.Q., Augusto, B.S. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r11 | | Status: | HPUB -- hold until publication | | Title: | Structure of the PRYSPRY domain of human MID2, crystal form II | | Authors: | Munoz Sosa, C.J., Zhubi, R., Chaikuad, A., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r07 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rat SLCO2A1 bound to zafirlukast. | | Authors: | Joshi, C., Newstead, S. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0a | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rat SLCO2A1 bound to fentiazac. | | Authors: | Joshi, C., Newstead, S. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0m | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rat SLCO2A1 bound to prostaglandin E2. | | Authors: | Deme, J.C., Goult, J., Lea, S.M., Newstead, S. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rat SLCO2A1 bound to dinoprost. | | Authors: | Deme, J.C., Joshi, C., Lea, S.M., Newstead, S. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rat SLCO2A1 bound to tolcapone. | | Authors: | Deme, J.C., Joshi, C., Lea, S.M., Newstead, S. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rat SLCO2A1 bound to losartan. | | Authors: | Joshi, C., Newstead, S. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r00 | | Status: | HPUB -- hold until publication | | Title: | De novo NTF2-like protein with a 2-helix C-terminal extension. | | Authors: | Nadal, M., Marcos, E., Castellvi, A. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glutathione transferase iota 1 from Synechocystis sp. PCC 6803 in complex with FMN | | Authors: | Didierjean, C., Hecker, A., Morette, L. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9umv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TRiC_HDAC1_prefoldin | | Authors: | Li, Z.L., Cong, Y.C. | | Deposition date: | 2025-04-23 |
|
| PDBID: | 9umt | | Status: | HPUB -- hold until publication | | Title: | TRiC_HDAC1_close_state | | Authors: | Li, Z.L., Cong, Y.C. | | Deposition date: | 2025-04-23 |
|
| PDBID: | 9umw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TRiC complex with bent CCT4 | | Authors: | Li, Z.L., Cong, Y.C. | | Deposition date: | 2025-04-23 |
|
| PDBID: | 9un4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of juvenile hormone acid methyltransferase castaneum JHAMT3 from Tribolium castaneum | | Authors: | Guo, P.C., Yang, Y.Y. | | Deposition date: | 2025-04-23 |
|
| PDBID: | 9oc9 | | Status: | HPUB -- hold until publication | | Title: | Human DHODH in complex with ligand H3D3181 | | Authors: | Arbelaez, M., Purificacao, A.D., Nonato, M.C. | | Deposition date: | 2025-04-23 |
|
