Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9qux
Status:HPUB -- hold until publication
Title:Solution structure of the Homer1 EVH1 domain
Authors:Czajlik, A., Maruzs, B., Fanni, F., Batta, G., Gaspari, Z., Peterfia, B.F.
Deposition date:2025-04-11
Sequence:

>Entity 1


GSHMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQ
PDBID:9ufo
Status:HOLD -- hold until a certain date
Title:Structure of the asymmetrically reconstructed phage T4 capsid-neck-tail complex
Authors:Shao, Q., Dong, J., Wang, A., Li, L., Zheng, Y., Li, H., Li, Y., Zhang, Q., Sun, L., Fokine, A., Rao, V.B., Tao, P., Fang, Q.
Deposition date:2025-04-10
Release date:2026-04-10
PDBID:9ufi
Status:HPUB -- hold until publication
Title:Crystal structure of a PhGs rhamnosyltransferase UGT79G15 from Rehmannia glutinosa in complex with UDP and FSA
Authors:Wei, H.L., Liu, W.D., Zhuang, Y.B., Liu, T.
Deposition date:2025-04-10
PDBID:9ufc
Status:HOLD -- hold until a certain date
Title:Structural of a glutamate cysteine ligase StGSH1 in Solanum tuberosum
Authors:Zhao, H.B., Fan, S.L.
Deposition date:2025-04-10
Release date:2026-04-10
PDBID:9uf7
Status:HPUB -- hold until publication
Title:Crystal structure of a PhGs rhamnosyltransferase UGT79G15 from Rehmannia glutinosa in complex with UDP
Authors:Wei, H.L., Liu, W.D., Zhuang, Y.B., Liu, T.
Deposition date:2025-04-10
PDBID:9o5p
Status:HPUB -- hold until publication
Title:Structure of ClpC1-NTD complexed with Diterpene B (GRDN0001)
Authors:Ratia, K., Lee, H., Abad-Zapatero, C.
Deposition date:2025-04-10
PDBID:9o61
Status:HPUB -- hold until publication
Title:R-phycoerythrin
Authors:Rashleigh, L., Venugopal, H., Rossjohn, J., Gully, B.S.
Deposition date:2025-04-10
PDBID:9o60
Status:HPUB -- hold until publication
Title:Local refinement of 1C5H TCR bound to R-phycoerythrin (gamma chain dimer)
Authors:Rashleigh, L., Venugopal, H., Rossjohn, J., Gully, B.S.
Deposition date:2025-04-10
PDBID:9o62
Status:HPUB -- hold until publication
Title:1C5H TCR bound to R-phycoerythrin
Authors:Rashleigh, L., Venugopal, H., Rossjohn, J., Gully, B.S.
Deposition date:2025-04-10
PDBID:9o5j
Status:HPUB -- hold until publication
Title:Human Aconitate Decarboxylase I apo form
Authors:Runge, B.R., Monteiro, D.C.F.
Deposition date:2025-04-10
PDBID:9o5n
Status:HPUB -- hold until publication
Title:Human Aconitate Decarboxylase I bound to citraconate
Authors:Runge, B.R., Monteiro, D.C.F.
Deposition date:2025-04-10
PDBID:9o5r
Status:HPUB -- hold until publication
Title:VAR2CSA in complex with V2C.044 Fab
Authors:Raghavan, S.S.R., Ward, A.B.
Deposition date:2025-04-10
PDBID:9o5b
Status:AUTH -- processed, waiting for author review and approval
Title:RNase A in complex with N1-Methylpseudouridine Vanadate and decavanadates
Authors:Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T.
Deposition date:2025-04-09
PDBID:9ue4
Status:HPUB -- hold until publication
Title:Serine Beta-Lactamase OXA-48 in Complex with MBL/SBL Inhibitor FB3-2
Authors:Li, G.-B., Wei, S.-Q.
Deposition date:2025-04-08
PDBID:9ueh
Status:HPUB -- hold until publication
Title:Serine Beta-Lactamase OXA-48 in Complex with MBL/SBL Inhibitor FB1-10
Authors:Li, G.-B., Wei, S.-Q.
Deposition date:2025-04-08
PDBID:9uem
Status:HPUB -- hold until publication
Title:Metallo-Beta-Lactamase VIM-2 in Complex with MBL/SBL Inhibitor FB1-12
Authors:Li, G.-B., Wei, S.-Q.
Deposition date:2025-04-08
PDBID:9o4v
Status:AUTH -- processed, waiting for author review and approval
Title:RNase A in complex with Pseudouridine Vanadate and decavanadates
Authors:Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T.
Deposition date:2025-04-08
PDBID:9qtg
Status:AUTH -- processed, waiting for author review and approval
Title:Simkania negevensis CE-clan virulence factor SnCE1 in complex with hsSUMO1
Authors:Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M.
Deposition date:2025-04-08
PDBID:9qte
Status:HPUB -- hold until publication
Title:Simkania negevensis CE-clan virulence factor SnCE1 wildtype
Authors:Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M.
Deposition date:2025-04-08
PDBID:9qtf
Status:HPUB -- hold until publication
Title:Simkania negevensis CE-clan virulence factor SnCE1 C256A catalytically inactive mutant
Authors:Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M.
Deposition date:2025-04-08
PDBID:9qsw
Status:HPUB -- hold until publication
Title:Crystal structure of an NtA622L variant in complex with NADP+ and Nicotinic acid
Authors:Mokos, D., Daniel, B.
Deposition date:2025-04-07
PDBID:9ud7
Status:HPUB -- hold until publication
Title:Crystal structure of human glutaminyl cyclase in complex with Inhibitor CL7
Authors:Li, G.-B., Ning, X.-L., Meng, F.-B., Chen, Y.-T.
Deposition date:2025-04-06
PDBID:9qsm
Status:HPUB -- hold until publication
Title:small molecule inhibitor in complex with PD-L1
Authors:Muszak, D., Kocik-Krol, J., Zaber, J., Kruc, O., Palej, U., Fijolkowska, K., Maslanka, A., Magiera-Mularz, K., Plewka, J., Stec, M., Siedlar, M., Musielak, B., Kitel, R., Skalniak, L., Surmiak, E.
Deposition date:2025-04-05
PDBID:9qs4
Status:HPUB -- hold until publication
Title:Structure of glycocin glycosyltransferase SacS from Streptomyces platensis
Authors:Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C.
Deposition date:2025-04-04
PDBID:9qrq
Status:HPUB -- hold until publication
Title:Structure of glycocin glycosyltransferase SacS from Streptomyces platensis
Authors:Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C.
Deposition date:2025-04-04

238582

数据于2025-07-09公开中

PDB statisticsPDBj update infoContact PDBjnumon