| PDBID: | 9pbo | | Status: | HPUB -- hold until publication | | Title: | Structure of NaCT-ETG5773-Citrate complex in Co-Ci conformation | | Authors: | Li, Y., Wang, D.N., Tajkhorshid, E., Mulligan, C., Mindell, J.A., Gonzalez, R.L., Song, J.M., Trebesch, A.N., Marden, J.J., Davies, J., Zahn, G., Birkenfeld, A. | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbp | | Status: | HPUB -- hold until publication | | Title: | Structure of NaCT-ETG5773 complex in Co-Ci conformation | | Authors: | Li, Y., Wang, D.N., Tajkhorshid, E., Mulligan, C., Mindell, J.A., Gonzalez, R.L., Song, J.M., Trebesch, A.N., Marden, J.J., Davies, J., Zahn, G., Birkenfeld, A. | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbq | | Status: | HPUB -- hold until publication | | Title: | Structure of NaCT-ETG5773 complex in Ci-Ci conformation | | Authors: | Li, Y., Wang, D.N., Tajkhorshid, E., Mulligan, C., Mindell, J.A., Gonzalez, R.L., Song, J.M., Trebesch, A.N., Marden, J.J., Davies, J., Zahn, G., Birkenfeld, A. | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pb3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pb7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pb8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbb | | Status: | HPUB -- hold until publication | | Title: | 293K human S-adenosylmethionine decarboxylase | | Authors: | Patel, J.R., Bonzon, T.J., Bahkt, T., Fagbohun, O.O., Clinger, J.A. | | Deposition date: | 2025-06-26 | | Sequence: | >Entity 1
MHHHHHHENLYFQGEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
>Entity 2
(PYR)SMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS
|
|
| PDBID: | 9pbw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pc1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pb4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pb5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pby | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pc0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pb6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pb1 | | Status: | HPUB -- hold until publication | | Title: | Human ClpP initial assembly | | Authors: | Chen, W.C. | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbc | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F/E166V Double Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbg | | Status: | HPUB -- hold until publication | | Title: | TCR 19.2 complex with YEIH-HLA B*27:05 | | Authors: | Jude, K.M., Xiang, X., Wang, N., Garcia, K.C. | | Deposition date: | 2025-06-26 |
|
| PDBID: | 9pbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-26 |
|
