| PDBID: | 9r6f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPS4BE | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 9r6g | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homodimer lobe region. Post-processed by DeepEMhancer using combined half maps. | | Authors: | Shutian, S. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6j | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homotetramer with D2 symmetry (DeepEMhancer) | | Authors: | Shutian, S. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPPH | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 9uvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-05-11 | | Release date: | 2026-08-11 |
|
| PDBID: | 9uvq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the oxytocin receptor bound to nanobody Nb2H4 | | Authors: | Gao, K., Nie, J., Zhang, X., Liu, X. | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uw2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvs | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of transaminase from Phaeobacter porticola | | Authors: | Heo, Y.-S. | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uw0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9oks | | Status: | HPUB -- hold until publication | | Title: | 16mer self-complementary duplex RNA with dA:U pair sequence 1 | | Authors: | Fang, Z., Szostak, J.W. | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9okt | | Status: | HPUB -- hold until publication | | Title: | 16mer self-complementary duplex RNA with dA:U pair sequence 2 | | Authors: | Fang, Z., Szostak, J.W. | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9oku | | Status: | HPUB -- hold until publication | | Title: | 16mer self-complementary duplex RNA with dA:s(2)U pair sequence 1 | | Authors: | Fang, Z., Szostak, J.W. | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9okv | | Status: | HPUB -- hold until publication | | Title: | 16mer self-complementary duplex RNA with dA:s(2)U pair sequence 2 | | Authors: | Fang, Z., Szostak, J.W. | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9okx | | Status: | HPUB -- hold until publication | | Title: | 16mer self-complementary duplex RNA with dG:C pair sequence 2 | | Authors: | Fang, Z., Szostak, J.W. | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9oky | | Status: | HPUB -- hold until publication | | Title: | 16mer self-complementary duplex RNA with dG:s(2)C pair sequence 1 | | Authors: | Fang, Z., Szostak, J.W. | | Deposition date: | 2025-05-11 |
|
