| PDBID: | 9qr6 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the tetrahedral M42 aminopeptidase from M. jannaschii | | Authors: | Atalah, J., Basbous, H., Girard, E., Effantin, E., Schoehn, G., Franzetti, B. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9qqw | | Status: | HPUB -- hold until publication | | Title: | LvrB - active conformation | | Authors: | Agustoni, E., Mechaly, A., Rizza, J.D., Beriashvili, D., Pluhackova, K., Isaikina, P., Trajtenberg, F., Muntener, T., Wunder, E., Ko, A., Schirmer, T., Buschiazzo, A., Hiller, S. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qr2 | | Status: | HPUB -- hold until publication | | Title: | LvrB inactive | | Authors: | Agustino, E., Buschiazzo, A., Hiller, S., Beriashvili, D. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qqp | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Mouse Ribosome rotated-2 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qql | | Status: | HPUB -- hold until publication | | Title: | Mouse RPS15 P131 Mutant Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qqf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the WIM8E5 Fab - HLA-A*11:01 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Humm, A.S., Pellegrini, E., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqc | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic ON | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqg | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic OFF | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9u9d | | Status: | HPUB -- hold until publication | | Title: | Bipartite Genetically Encoded Biosensor sG-GECO1 | | Authors: | Wen, Y., Campbell, R.E. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the substrate-bound state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., Bhattacharjee, B., di Muccio, G., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the pre-catalysis and product-bound state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nye | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the apo state (octamer volume) | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nym | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 allosteric loop mutant, N448A | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the pre-intermediate state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB (tetramer volume) | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpk | | Status: | HPUB -- hold until publication | | Title: | E.coli TalB mutant E96Q, F178Y, R300E | | Authors: | Soderholm, A., Roos, A., Widersten, M. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qoh | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoq | | Status: | HPUB -- hold until publication | | Title: | Leishmania donovani ISP2 in complex with bovine trypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qog | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Affitin C10 in complex with a a double-helical aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Sachs, J., Merlet, E., Ferrand, Y., Huc, I. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u77 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Glycogen branching enzyme (VvGBE) from Vibrio vulnificus MO6-24/O | | Authors: | An, Y., Lee, S.J., Park, J.T., Woo, E.J. | | Deposition date: | 2025-03-24 | | Sequence: | >Entity 1
MRIVFTTLAVWRGKKGLKKLVKSKVNQMFEKLSQAACSEPFAFLGPFIDPTQGALRVWMPGATGVALVLEGQPRIALEREKESAFILKADLNLHLTHYQLAIDWNGVEQLIDDPYQYHGIYAEYDDLHTPKTMYQHMGSQFMTLERDGKSISGIRFLVYAPHATAVSLVGCFNDWDGRRHPMQRLDYGIWGLFIPGLTEGVSYKFEMKGPKGEGLPHKADPWGFYAEQYPSFASVTYDHARYQWQDAQWQTRPVTEKRKEALSFYELHAGSWKRNEQGEFLNYRELAAELVPYLVDMGYTHVELMPVSEHPFYGSWGYQPVGLFAPTSRYGSPDDFKFFVDACHQAGIGVVLDWVPAHFPSDDHGLANFDGTPLFHDPDPRRGWHQDWNSFIYDLGREQVRRFLVSNALYWFEQFHIDGIRVDAVASMLYLDYSRSHGQWIPNMDGGNENYDAIATLKWMNEEVYKYFPNAMTIAEESTAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYIKEEPVHRKYHHNTLTFPLVYAHSENYVLSLSHDEVVYGKGSIHNKMPGDEWQQTANLRAYFGYMYGQPGKKLNFMGAEIGQTAEWNHDDQLQWFLLDFPRHQGVQALTRDLNHLYRNEAALHDQDCIPAGFEWRLQDAAEQSIIAHERISEAGERILVVSNFTPVPRDEFRLGVPNKGRYQLLLNTDDSKYAGSGYEVVVDAKSEAVVSEDLAQSIVLRLPPLSTLFYKLV
|
|
| PDBID: | 9nwt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of DDB1dB:CRBN:mezigdomide:SALL4(392-449;G416A) | | Authors: | Park, J., Hunkeler, M., Roy Burman, S.S., Fischer, E.S. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9u5v | | Status: | HPUB -- hold until publication | | Title: | Structure of Chloroflexus aggregans flavin based fluorescent protein (CagFbFP) Q89E variant (complex with LC) | | Authors: | Nikolaev, A., Markeeva, E., Remeeva, A., Borshchevsky, V., Gushchin, I. | | Deposition date: | 2025-03-22 |
|
| PDBID: | 9u5n | | Status: | HPUB -- hold until publication | | Title: | Structure of Chloroflexus aggregans flavin based fluorescent protein (CagFbFP) Q89E variant (complex with FMN) | | Authors: | Nikolaev, A., Markeeva, E., Kovalev, K., Gushchin, I. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP204 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qm7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S-nitrosylated triose phosphate isomerase from Chlamydomonas reinhardtii | | Authors: | Fanti, S., Fermani, S., Gabellini, G., Zaffagnini, M., Meloni, M., Peppi, G.M.E. | | Deposition date: | 2025-03-21 | | Sequence: | >Entity 1
ASSAKFFVGGNWK(SNC)NGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
|
|
