| PDBID: | 7ilv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition for crystallographic fragment screening of SARS-CoV-2 nucleocapsid protein (CTD) -- Crystal Structure of SARS-CoV-2 nucleocapsid protein (CTD) in complex with Z31385861 (Nprot-x0230) | | Authors: | Aschenbrenner, J.C., Luptak, J., Balcomb, B.H., Marples, P.G., Bellini, D., Yu, C.W., Douangamath, A., Dias, A., Powell, A., Fearon, D., James, L., von Delft, F. | | Deposition date: | 2025-08-11 |
|
| PDBID: | 7imj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition for crystallographic fragment screening of SARS-CoV-2 nucleocapsid protein (CTD) -- Crystal Structure of SARS-CoV-2 nucleocapsid protein (CTD) in complex with Z2527301677 (Nprot-x0403) | | Authors: | Aschenbrenner, J.C., Luptak, J., Balcomb, B.H., Marples, P.G., Bellini, D., Yu, C.W., Douangamath, A., Dias, A., Powell, A., Fearon, D., James, L., von Delft, F. | | Deposition date: | 2025-08-11 |
|
| PDBID: | 7imk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition for crystallographic fragment screening of SARS-CoV-2 nucleocapsid protein (CTD) -- Crystal Structure of SARS-CoV-2 nucleocapsid protein (CTD) in complex with Z1270312110 (Nprot-x0412) | | Authors: | Aschenbrenner, J.C., Luptak, J., Balcomb, B.H., Marples, P.G., Bellini, D., Yu, C.W., Douangamath, A., Dias, A., Powell, A., Fearon, D., James, L., von Delft, F. | | Deposition date: | 2025-08-11 |
|
| PDBID: | 7iml | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition for crystallographic fragment screening of SARS-CoV-2 nucleocapsid protein (CTD) -- Crystal Structure of SARS-CoV-2 nucleocapsid protein (CTD) in complex with Z1220452176 (Nprot-x0423) | | Authors: | Aschenbrenner, J.C., Luptak, J., Balcomb, B.H., Marples, P.G., Bellini, D., Yu, C.W., Douangamath, A., Dias, A., Powell, A., Fearon, D., James, L., von Delft, F. | | Deposition date: | 2025-08-11 |
|
| PDBID: | 7imm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition for crystallographic fragment screening of SARS-CoV-2 nucleocapsid protein (CTD) -- Crystal Structure of SARS-CoV-2 nucleocapsid protein (CTD) in complex with Z166605480 (Nprot-x0438) | | Authors: | Aschenbrenner, J.C., Luptak, J., Balcomb, B.H., Marples, P.G., Bellini, D., Yu, C.W., Douangamath, A., Dias, A., Powell, A., Fearon, D., James, L., von Delft, F. | | Deposition date: | 2025-08-11 |
|
| PDBID: | 7imn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition for crystallographic fragment screening of SARS-CoV-2 nucleocapsid protein (CTD) -- Crystal Structure of SARS-CoV-2 nucleocapsid protein (CTD) in complex with Z744754722 (Nprot-x0467) | | Authors: | Aschenbrenner, J.C., Luptak, J., Balcomb, B.H., Marples, P.G., Bellini, D., Yu, C.W., Douangamath, A., Dias, A., Powell, A., Fearon, D., James, L., von Delft, F. | | Deposition date: | 2025-08-11 |
|
| PDBID: | 7imo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition for crystallographic fragment screening of SARS-CoV-2 nucleocapsid protein (CTD) -- Crystal Structure of SARS-CoV-2 nucleocapsid protein (CTD) in complex with Z68404778 (Nprot-x0477) | | Authors: | Aschenbrenner, J.C., Luptak, J., Balcomb, B.H., Marples, P.G., Bellini, D., Yu, C.W., Douangamath, A., Dias, A., Powell, A., Fearon, D., James, L., von Delft, F. | | Deposition date: | 2025-08-11 |
|
| PDBID: | 7imt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition for crystallographic fragment screening of SARS-CoV-2 nucleocapsid protein (CTD) -- Crystal Structure of SARS-CoV-2 nucleocapsid protein (CTD) in complex with Z1639162606 (Nprot-x0543) | | Authors: | Aschenbrenner, J.C., Luptak, J., Balcomb, B.H., Marples, P.G., Bellini, D., Yu, C.W., Douangamath, A., Dias, A., Powell, A., Fearon, D., James, L., von Delft, F. | | Deposition date: | 2025-08-11 |
|
| PDBID: | 9sb2 | | Status: | HPUB -- hold until publication | | Title: | Structure of Yeast RNA polymerase II elongation complex with NTP-state-VII-B | | Authors: | Yi, G., Li, Q., Zhang, P., Wang, D. | | Deposition date: | 2025-08-08 |
|
| PDBID: | 9pyk | | Status: | HPUB -- hold until publication | | Title: | Q12BBM-069 Fab in complex with HIV-1 Env BG505 NFL TD CC3+ | | Authors: | Phulera, S., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9pyh | | Status: | HPUB -- hold until publication | | Title: | Q9M-023 Fab in complex with HIV-1 Env BG505 NFL TD CC3+ | | Authors: | Phulera, S., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9pyd | | Status: | HPUB -- hold until publication | | Title: | Q12QBM-007 Fab in complex with HIV-1 Env BG505 NFL TD CC3+ | | Authors: | Phulera, S., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9w7x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of dPIEZO channel | | Authors: | Liu, S., Li, X., Xiao, B. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9pxr | | Status: | HPUB -- hold until publication | | Title: | Human malic enzyme 1 complex with inhibitor NPD-389 at 2.3 Angstrom. | | Authors: | Krinkel, B.A., Yosaatmadja, Y., Squire, C.J., Loomes, K.M. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9py5 | | Status: | HPUB -- hold until publication | | Title: | Q10M-055 Fab in complex with HIV-1 Env Q23 NFL TD CC3+ | | Authors: | Phulera, S., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9w7d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | cryo-EM structure of PSII PsbA3-S264V in complex with DCMU from Thermosynechococcus vestitus BP-1 | | Authors: | Fan, S.B., Jiang, H.W., Kato, K., Tsai, P.-C., Jia, A.Q., Nakajima, Y., Sugiura, M., Shen, J.R. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9w7t | | Status: | HPUB -- hold until publication | | Title: | SuperFi Cas9 - 20nt sgRNA - DNA ternary complex Class B | | Authors: | Zheng, R., Ma, L.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9s99 | | Status: | HPUB -- hold until publication | | Title: | CdvB2 filament - high twist, class B | | Authors: | Drobnic, T., Lowe, J. | | Deposition date: | 2025-08-06 | | Sequence: | >Entity 1
MADVNDFLRNWGGRQEPTISEKIKNLFKSQQPLRYRLVMANYRLRTTISRLDVYISKLQERDRSLFEKVVESQISKDSARAAMYANEIAEIRKITKQLLTTEIALEQVQLRLETITEIGDIFTSLVPVIGVIRELRNVMKGVMPELSIELADLEEGLQEVVLEAGEFTGARVDFATSSPEARKILDEASAVAEQRMKEKFPSLPSFATSVDQKTNANQK
|
|
| PDBID: | 9s9f | | Status: | HPUB -- hold until publication | | Title: | Crystal of cardiotoxin (P01468) Naja pallida | | Authors: | Burlet, N.J., Bertelsen, A.B., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9pxa | | Status: | HPUB -- hold until publication | | Title: | BG505/CH505wk4 Env chimeric SOSIP in complex with CH103 and RM19R Fabs | | Authors: | Cottrell, C.A., Ozorowski, G., Wu, N.R., Ward, A.B. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9pxe | | Status: | HPUB -- hold until publication | | Title: | JRFL.TD15 membrane Env liposome in complex with CH103.H17L8 Fab | | Authors: | Karlinsey, D.C., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9pw3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of renal amyloid fibril from a variant apolipoprotein A-I R173P amyloidosis patient | | Authors: | Nguyen, B.A., Saelices, L. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9pvn | | Status: | HPUB -- hold until publication | | Title: | Human malic enzyme 3 complex with inhibitor NPD-389 at 1.82 Angstrom. | | Authors: | Krinkel, B.A., Yosaatmadja, Y., Squire, C.J., Loomes, K.M. | | Deposition date: | 2025-08-02 |
|
| PDBID: | 9s73 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex of Equine Serum Albumin with Ampicillin | | Authors: | Duszynski, K., Sekula, B., Bujacz, A., Bujacz, G. | | Deposition date: | 2025-08-02 |
|
| PDBID: | 9w5b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | cryo-EM structure of PSII D1-S264V from Thermosynechococcus vestitus BP-1 | | Authors: | Fan, S.B., Jiang, H.W., Kato, K., Tsai, P.-C., Jia, A.Q., Nakajima, Y., Sugiura, M., Shen, J.-R. | | Deposition date: | 2025-08-01 |
|
